Protein detail
CD9
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Entry name CD9 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 409 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
409
EVMP confidence score
0.88
Fluorescence & Localization
Function & Pathway
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
- GO:0032991 protein-containing complex
- GO:0070062 extracellular exosome
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (10)
- R-hsa-1300645 acrosome reaction and sperm oocyte membrane binding
- R-hsa-9824439 bacterial infection pathways
- R-hsa-1187000 fertilization
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-1474165 reproduction
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-5339562 uptake and actions of bacterial toxins
- R-hsa-5336415 uptake and function of diphtheria toxin
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | HPMR | Yes | ||||
| extracellular | extracellular | DGIdb | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes |
Page 1 of 4Next
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ASAP3CD96CER1HSPA1BLDB3 | O75112O95813P0DMV9P40200Q8TDY4 | 0:0:0:0:0 | hu.MAP2 | |||
| CD96HSPA1ALDB3 | O75112P0DMV8P40200 | 0:0:0 | hu.MAP | |||
| CD96HSPA1BLDB3 | O75112P0DMV9P40200 | 0:0:0 | hu.MAP | |||
| AFG2BCD96HSPA1BLDB3 | O75112P0DMV9P40200Q9BVQ7 | 0:0:0:0 | hu.MAP2 | |||
| CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1 | O95067P24387P40200P61599Q13501Q15025Q8NBL1 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| CD99 | P14209 | 2 | PDB | PDB:7sfx | ||
| CD9 | P21926 | 4 | PDB | PDB:6z20PDB:6rlrPDB:6rlo | ||
| CD93 | Q9NPY3 | 4 | PDB | PDB:8ivd |
Sequence, Structure & Domains
Sequences
Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
3D Structural Models
Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Drugs (43)
FLUOXETINE HYDROCHLORIDEDOTHIEPINPROPIONIBACTERIUM ACNESNORZOTEPINECITALOPRAMZIPRASIDONEMILNACIPRANVENLAFAXINEIMIPRAMINE HYDROCHLORIDELUMATEPERONEFLUVOXAMINERECOMBINANT EOTAXINTHERAPEUTIC STEROID HORMONEPAROXETINE HYDROCHLORIDE, HEMIHYDRATESIBUTRAMINETYROSINE KINASE INHIBITORLEVOMILNACIPRANATOMOXETINE HYDROCHLORIDEVORTIOXETINE HYDROBROMIDEZOTEPINEPROTRIPTYLINEDULOXETINE HYDROCHLORIDENORTRIPTYLINE[3H]PAROXETINERECOMBINANT INTERLEUKIN-16LIFTHERAPEUTIC ANDROGENDESIPRAMINEAMOXAPINESERTRALINE HYDROCHLORIDEIL-5DESVENLAFAXINE SUCCINATELOFEPRAMINEDOXEPIN HYDROCHLORIDECLOMIPRAMINETOLUDESVENLAFAXINEHERBIMYCIN ANEFAZODONEPHENELZINEVILAZODONE HYDROCHLORIDEDAPOXETINEAMITRIPTYLINE HYDROCHLORIDETRIMIPRAMINE
Antibody
Interaction Protein (2)
ENSG00000110651ENSG00000134247
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell
Supporting Publications409
| PMID | Title | Related sentences |
|---|---|---|
| 28534915 | Quantum dot-based sensitive detection of disease specific exosome in serum. | The assay involves three subsequent steps where bulk exosome populations are initially magnetically captured on magnetic beads by a generic tetraspanin antibody (e.g., CD9 or CD63) followed by the identification of disease-specific exosomes using cancer-related. |
| 28542562 | Identification and characteristics of extracellular vesicles from bovine blastocysts produced in vitro. | Flow cytometry analysis allowed identifying CD63 and CD9 proteins as exosome markers. |
| 28629620 | Effects of Inhibiting VPS4 Support a General Role for ESCRTs in Extracellular Vesicle Biogenesis. | Taken together, our data indicate that VPS4 activity is important for generating exosomes and ectosomes, thereby generally implicating the ESCRT machinery in EV biogenesis. |
| 28701751 | Secretome of in vitro cultured human embryos contains extracellular vesicles that are uptaken by the maternal side. | Here we demonstrate for the first time that conditioned media from non-manipulated human embryos cultured in vitro for 3 days or up to the blastocyst stage contain extracellular vesicles (EVs) with a diameter of 50 to 200\xe2\x80\x89nm and bearing the traditional microvesicle and exosome marker proteins CD63, CD9 and ALIX. |
| 28740388 | Role of TIM-4 in exosome-dependent entry of HIV-1 into human immune cells. | Role of TIM-4 in exosome-dependent entry of HIV-1 into human immune cells. The size and concentration of purified exosomes were measured by nanoparticle tracking, while Western blotting confirmed the presence of the exosomal-associated proteins CD9 and CD63, clathrin, and T cell immunoglobulin and mucin proteins (TIMs). This mechanism is supported by our findings that exosomes from multiple sources increased HIV-1 entry into T cells and macrophages, and viral entry was potently blocked with anti-TIM-4 antibodies. |
| 28823103 | Bariatric Surgery Is Accompanied by Changes in Extracellular Vesicle-Associated and Plasma Fatty Acid Binding Protein 4. | EV origin (CD9: exosome; CD41: platelet; CD235a: erythrocyte; CD11b: leukocyte; CD144: endothelial), cytokine (interferon \xce\xb3, interleukin-6, TNF-\xce\xb1) and adipocyte marker (adiponectin, FABP4, PPAR\xce\xb3) expression was measured by time-resolved fluorescence immunoassay. |
| 28847700 | The HBx gene of hepatitis B virus can influence hepatic microenvironment via exosomes by transferring its mRNA and protein. | Here, we show that HBx can tweak the exosome biogenesis machinery both by enhancing neutral sphingomyelinase2 activity as well as by interacting with exosomal biomarkers such as neutral sphingomyelinase2, CD9 and CD81. The nano particle tracking analysis revealed enhanced secretion of exosomes by the HBx-expressing cells while confocal studies confirmed the co-localization of HBx with CD9 and CD63. |
| 28850588 | New evidence that a large proportion of human blood plasma cell-free DNA is localized in exosomes. | A large proportion of extracellular vesicles isolated from plasma were identified as exosomes using a fluorescence probe specific for exosomes and three protein markers, Hsp70, CD9 and CD63, that are commonly used to identify exosome fraction. |
| 28878075 | Characterization of the Quasi-Enveloped Hepatitis E Virus Particles Released by the Cellular Exosomal Pathway. | Purified CD63-, CD9-, or CD81-positive exosomes derived from the culture supernatants of HEV-infected cells that had been cultivated in serum-free medium were found to contain HEV RNA and the viral capsid (ORF2) and ORF3 proteins, as determined by reverse transcription-PCR (RT-PCR) and Western blotting, respectively. |
| 28881726 | Modulation of paracrine signaling by CD9 positive small extracellular vesicles mediates cellular growth of androgen deprived prostate cancer. | Herein, we identify the secretion of CD9 positive extracellular vesicles (EV) by LNCaP and DUCaP PCa cells in response to dihydrotestosterone (DHT) and use nano-LC-MS/MS to identify the proteins present in these EV. Modulation of paracrine signaling by CD9 positive small extracellular vesicles mediates cellular growth of androgen deprived prostate cancer. |