Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name CD9	UniProt ID P21926	EVMP confidence score 0.88
Supporting publications (n) 424	Transmembrane count 4	Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Protein Class (5)

Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical

Transmembrane Count

Ensembl

ENSG00000010278

Entrez Gene Symbol

CD9

Gene Synonym (5)

BA2MIC3MRP-1P24TSPAN29

Gene Description

CD9 molecule

Chromosome

Position

6199715-6238271

Supporting publications (n)

424

EVMP confidence score

0.88

Fluorescence & Localization1

Function & Pathway7

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (11)

Page 1 of 2

Molecular Function (2)

Biological Process (3)

KEGG (2)

Reactome (10)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	HPMR	No	No	Yes	No	No
extracellular	extracellular	DGIdb	No	No	Yes	No	No
extracellular	extracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	LOCATE	No	No	Yes	No	No
intracellular	intracellular	ComPPI	No	No	Yes	No	No
intracellular	intracellular	GO_Intercell	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
cell_surface_ligand	cell_surface_ligand	connectomeDB2020	Yes	No	Yes	No	No
cell_surface_ligand	cell_surface_ligand	Baccin2019	Yes	No	Yes	No	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	Yes	No	No

Page 1 of 4Next

Protein Complex Composition (8)

8 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ASAP3 CD96 CER1 HSPA1B LDB3	O75112 O95813 P0DMV9 P40200 Q8TDY4	0:0:0:0:0	hu.MAP2
CD96 HSPA1A LDB3	O75112 P0DMV8 P40200	0:0:0	hu.MAP
CD96 HSPA1B LDB3	O75112 P0DMV9 P40200	0:0:0	hu.MAP
AFG2B CD96 HSPA1B LDB3	O75112 P0DMV9 P40200 Q9BVQ7	0:0:0:0	hu.MAP2
CCNB2 CD96 CRHBP NAA20 POGLUT1 SQSTM1 TNIP1	O95067 P24387 P40200 P61599 Q13501 Q15025 Q8NBL1	0:0:0:0:0:0:0	hu.MAP2
CD99	P14209	2	PDB	PDB:7sfx
CD9	P21926	4	PDB	PDB:6z20PDB:6rlrPDB:6rlo
CD93	Q9NPY3	4	PDB	PDB:8ivd

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	2	37667547 36849061

Sequence, Structure & Domains8

Sequences

Length

228

Mass

25,416

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn

154..156; 169..172

Helix

5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance6

Disease Involvement

Cancer-related genes

Drugs (43)

Antibody

CAB002490

Interaction Protein (2)

ENSG00000110651ENSG00000134247

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid_opencell

Supporting Publications409

PMID	Title	Abstract
37357556	Milk Exosomes from Gestational Diabetes Mellitus (GDM) and Healthy Parturient Exhibit Differential miRNAs Profiles and Distinct Regulatory Bioactivity on Hepatocyte Proliferation.	As compared to NOR-EXO, GDM-EXO has similar morphology, size, concentration, and exosome-specific markers (CD9 and TSG101) expression.
37386835	Rectal cancer-derived exosomes activate the nuclear factor kappa B pathway and lung fibroblasts by delivering integrin beta-1.	No abstract available
37445655	Lyophilization Based Isolation of Exosomes.	The expression of MUC1 protein on the exosomes isolated from MCF-7 cells also indicated that their potential diagnostic properties were intact.
37479071	Plasma exosomes proteome profiling discovers protein markers associated with the therapeutic effect of Chaihu-Longgu-Muli decoction on temporal lobe epilepsy.	Among them, RPL6, NCL, and LDHA protein levels were downregulated and APOA1 protein level was upregulated in the plasma exosomes of TLE patients.
37536457	Blood exosome marker miRNA-30d-5p: Role and regulation mechanism in cell stemness and gemcitabine resistance of hepatocellular carcinoma.	Blood exosome-derived miRNA-30d-5p promoted the stemness and gemcitabine resistance of HCC cells by repressing SOCS3 expression.
37948136	Study on tumour cell-derived hybrid exosomes as dasatinib nanocarriers for pancreatic cancer therapy.	Major protein analysis from western blot techniques reveal the presence of exosome marker proteins CD9 and CD81.
37968711	Human umbilical cord mesenchymal stem cell-derived exosomes promote microcirculation in aged diabetic mice by TGF-β1 signaling pathway.	The mechanism may be associated with exosomes rich in TGF-β1, which is likely to promote endothelial cell proliferation and improve permeability through binding to the endothelial CD105/TβR-II receptor complex, while promoting angiogenesis and protecting skeletal muscle cells from apoptosis. Therefore, this study verified the changes of CD105 in the exosome group, and it was used as the mechanism study of this study. Western blot analysis showed that the expression of CD105 protein in lower limb muscle tissue of exosome group was significantly increased compared with that of PBS group. Western blot showed positive expression of specific proteins CD9, CD81 and TSG101 on exosomes.2.
38069981	Influence of the isolation method on characteristics and functional activity of mesenchymal stromal cell-derived extracellular vesicles.	MSC-EVs isolated from IEX and UF were positive for the exosome markers CD9, CD63 and CD81 and showed a comparable surface marker expression pattern.
38072191	Rab11 suppresses head and neck carcinoma by regulating EGFR and EpCAM exosome secretion.	Rab11(Rab11a and Rab11b) localizes primarily along recycling endosomes in cells and is involved in various intracellular trafficking processes, including membrane receptor recycling and secretion of exosomes or small extracellular vesicles (EVs). The knockdown of Rab11a or Rab11b increased EpCAM/CD9 exosome secretion in addition to the migratory and invasive potential of HNSCC cells.
38072803	Metabolic labelling of a subpopulation of small extracellular vesicles using a fluorescent palmitic acid analogue.	The characterization of Bodipy-labelled exosomes reveals their enrichment in tetraspanin markers, particularly CD63 and CD81, and in minor proportion CD9.

Page 38 of 41Previous Next