Protein detail
ITA6
Integrin alpha-6 (CD49 antigen-like family member F) (VLA-6) (CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6 (Alpha6p)]
Protein symbol ITA6 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Integrin alpha-6 (CD49 antigen-like family member F) (VLA-6) (CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6 (Alpha6p)]
Protein Class
Cancer-related genesCD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- CD markers
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Transmembrane
1051..1076; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD49f
Gene Description
Integrin subunit alpha 6
Chromosome
2
Position
172427354-172506459
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Cell SpecificAstrocytesSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell Specificneutrophil
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- CD markers
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04382 Cornified envelope formation
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05222 Small cell lung cancer
- KEGG:hsa05410 Hypertrophic cardiomyopathy
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
- KEGG:hsa05414 Dilated cardiomyopathy
Reactome
- R-hsa-2022090 assembly of collagen fibrils and other multimeric structures
- R-hsa-210991 basigin interactions
- R-hsa-1500931 cell cell communication
- R-hsa-446728 cell junction organization
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-1474290 collagen formation
- R-hsa-9734767 developmental cell lineages
- R-hsa-9734779 developmental cell lineages of the integumentary system
- R-hsa-9924644 developmental lineages of the mammary gland
- R-hsa-9927426 developmental lineage of mammary gland alveolar cells
- R-hsa-9927418 developmental lineage of mammary gland luminal epithelial cells
- R-hsa-9927432 developmental lineage of mammary gland myoepithelial cells
- R-hsa-9938206 developmental lineage of mammary stem cells
- R-hsa-9725554 differentiation of keratinocytes in interfollicular epidermis in mammalian skin
- R-hsa-1474244 extracellular matrix organization
- R-hsa-109582 hemostasis
- R-hsa-216083 integrin cell surface interactions
- R-hsa-3000157 laminin interactions
- R-hsa-3000171 non integrin membrane ecm interactions
- R-hsa-3000170 syndecan interactions
- R-hsa-446107 type i hemidesmosome assembly
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| integrins | receptor | HPMR | No | Yes | No | Yes | No |
| itab | receptor | HPMR | No | Yes | No | Yes | No |
| integrin | receptor | Surfaceome | No | Yes | No | Yes | No |
| cell_adhesion | receptor | ICELLNET | No | Yes | No | Yes | No |
| ecm_interaction | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ITA6 | P23229 | PMP22 | Q01453 | Yes | Yes | No | SIGNOR | SIGNOR:16436605 |
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 38008423 |
Sequence, Structure & Domains
Sequences
Length
1,130
Mass
126,606
Sequence
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWITKWNENESYS
Alternative Products
Event=Alternative splicing; Named isoforms=8; Comment=Additional isoforms seem to exist. There is a combination of at least four alternatively spliced domains, two extracellular (X1 and X2) and two cytoplasmic (A and B). So far detected are isoform Alpha-6X1A, isoform Alpha-6X1B and isoform Alpha-6X1X2A (minor). Experimental confirmation may be lacking for some isoforms.; Name=Alpha-6X1X2B; IsoId=P23229-1; Sequence=Displayed; Name=Alpha-6X1A; IsoId=P23229-2; Sequence=VSP_002724, VSP_002725; Name=Alpha-6X1B; IsoId=P23229-3; Sequence=VSP_002724; Name=Alpha-6X2A; IsoId=P23229-4; Sequence=VSP_002723, VSP_002725; Name=Alpha-6X2B; IsoId=P23229-5; Sequence=VSP_002723; Name=Alpha-6X1X2A; IsoId=P23229-6; Sequence=VSP_002725; Name=7; IsoId=P23229-7; Sequence=VSP_036406, VSP_002723, VSP_002725; Name=9; IsoId=P23229-9; Sequence=VSP_036407, VSP_002725
Alternative Sequence
1..114; Missing (in isoform 7); 215..258; Missing (in isoform Alpha-6X2A, isoform Alpha-6X2B and isoform 7); 259..297; Missing (in isoform Alpha-6X1A and isoform Alpha-6X1B); 918..932; Missing (in isoform 9); 1084..1130; SRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWITKWNENESYS -> NKKDHYDATYHKAEIHAQPSDKERLTSDA (in isoform Alpha-6X1A, isoform Alpha-6X2A, isoform Alpha-6X1X2A, isoform 7 and isoform 9)
3D Structural Models
Turn
30..32; 105..107; 174..177; 182..187
Helix
210..213; 322..324
Beta Strand
34..37; 46..53; 59..66; 75..79; 81..87; 115..121; 128..132; 136..140; 147..149; 153..157; 159..162; 165..170; 192..196; 203..207; 215..220; 299..319; 326..333; 335..347; 357..362; 367..369; 371..376; 389..393; 406..409; 420..424; 429..431; 433..438; 445..452; 455..465; 467..479; 481..486; 488..501; 506..517; 527..529; 535..550; 557..563; 587..590; 600..607; 619..624; 652..660
3D Structure
Electron microscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Repeat
30..95; FG-GAP 1; 101..166; FG-GAP 2; 176..229; FG-GAP 3; 283..339; FG-GAP 4; 340..402; FG-GAP 5; 403..458; FG-GAP 6; 459..518; FG-GAP 7
Motif
1079..1083; GFFKR motif
Region
1077..1083; Interaction with HPS5
Protein Families
Integrin alpha chain family
Sequence Similarities
Belongs to the integrin alpha chain family.