Protein detail
COF1
Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform)
Entry name COF1 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 37 | Transmembrane count | Protein classification Essential proteinsPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform)
Protein Class (3)
Essential proteinsPlasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
CFL
Gene Description
Cofilin 1
Chromosome
11
Position
65823022-65862026
Supporting publications (n)
37
EVMP confidence score
0.88
Fluorescence & Localization
Tissue SpecificintestineCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (14)
- GO:0005615 extracellular space
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005925 focal adhesion
- GO:0015629 actin cytoskeleton
- GO:0016020 membrane
- GO:0016363 nuclear matrix
- GO:0030027 lamellipodium
- GO:0030426 growth cone
Page 1 of 2
Molecular Function (2)
KEGG (5)
Reactome (18)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-8950505 gene and protein expression by jak stat signaling after interleukin 12 stimulation
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-447115 interleukin 12 family signaling
- R-hsa-9020591 interleukin 12 signaling
- R-hsa-9675108 nervous system development
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence53
Enzyme-Mediated Modification (21)
21 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CFL1 | PDXP | Q96GD0 | S | 3 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:15580268 |
Page 3 of 3Previous
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | ||||
| ecm | ecm | OmniPath | Yes | ||||
| extracellular | extracellular | LOCATE | |||||
| extracellular | extracellular | OmniPath | |||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| actin_regulation_adhesome | intracellular_intercellular_related | Adhesome | Yes |
Page 1 of 2Next
Regulatory Interaction Network (16)
16 records.
Page 2 of 2Previous
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Cofilin-actin-CAP1 complex | ACTBCAP1CFL1 | P23528P60709Q01518 | 1:1:1 | CompleatCORUM | CORUM:2255Compleat:HC404 | 11950878 |
| ACTA1CFL1CNN1TAGLNTNNC1TPI1TPM3TRAP1UBC | P06753P0CG48P23528P51911P60174P63316P68133Q01995Q12931 | 1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5395 | ||
| CFL1HSPA4LIMK1LIMK2ODC1ROCK1 | P11926P23528P34932P53667P53671Q13464 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7430 | ||
| CFL1LIMK1 | P23528P53667 | 2:2 | PDB | PDB:5hvkPDB:5l6w |
Sequence, Structure & Domains
Sequences
Length
166
Mass
18,502
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
3D Structural Models
Turn
61..63
Helix
9..19; 26..31; 57..59; 67..74; 111..127; 140..144; 147..154; 155..157
Beta Strand
33..40; 44..56; 77..79; 81..90; 95..104; 134..139; 160..165
3D Structure
Electron microscopy (5); NMR spectroscopy (2); X-ray crystallography (4)
Domain & Motif Annotations
Motif
30..34; Nuclear localization signal
Domain (FT)
4..153; ADF-H
Protein Families
Actin-binding proteins ADF family
Sequence Similarities
Belongs to the actin-binding proteins ADF family.
Clinical Relevance
Drugs (8)
Interaction Protein (7)
ENSG00000075624ENSG00000106683ENSG00000112186ENSG00000124788ENSG00000159251ENSG00000165410ENSG00000184009
Interaction Count
7
Interaction Dataset (5)
intact_biogrid_opencell_bioplexintact_biogridbiogrid_bioplexintact_biogrid_bioplexintact_biogrid_opencell
Supporting Publications37
| PMID | Title | Related sentences |
|---|---|---|
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No related sentences available |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No related sentences available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No related sentences available |
| 34064677 | Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells. | No related sentences available |
| 34473505 | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No related sentences available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No related sentences available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |
| 36497184 | Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells. | No related sentences available |
| 37204515 | Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma. | No related sentences available |