Protein detail
AT2B4
Plasma membrane calcium-transporting ATPase 4 (PMCA4) (EC 7.2.2.10) (Matrix-remodeling-associated protein 1) (Plasma membrane calcium ATPase isoform 4) (Plasma membrane calcium pump isoform 4)
Entry name AT2B4 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 2 | Transmembrane count 10 | Protein classification EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Plasma membrane calcium-transporting ATPase 4 (PMCA4) (EC 7.2.2.10) (Matrix-remodeling-associated protein 1) (Plasma membrane calcium ATPase isoform 4) (Plasma membrane calcium pump isoform 4)
Protein Class (6)
EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Enzymes
- ENZYME proteins
- Transporters:Primary Active Transporters
- FDA approved drug targets:Small molecule drugs
Transmembrane
93..113; Helical; 151..171; Helical; 357..376; Helical; 410..427; Helical; 841..860; Helical; 871..891; Helical; 912..934; Helical; 953..974; Helical; 994..1015; Helical; 1026..1047; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ATP2B2MXRA1PMCA4
Gene Description
ATPase plasma membrane Ca2+ transporting 4
Chromosome
1
Position
203626832-203744081
Supporting publications (n)
2
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificlungBrain Regional SpecificcerebellumCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- Enzymes
- ENZYME proteins
- Transporters:Primary Active Transporters
- FDA approved drug targets:Small molecule drugs
Cellular Component (13)
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0030018 Z disc
- GO:0030315 T-tubule
- GO:0032991 protein-containing complex
- GO:0036126 sperm flagellum
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045121 membrane raft
Page 1 of 2
Molecular Function (13)
- GO:0005388 P-type calcium transporter activity
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0005524 ATP binding
- GO:0015085 calcium ion transmembrane transporter activity
- GO:0016887 ATP hydrolysis activity
- GO:0017080 sodium channel regulator activity
- GO:0019901 protein kinase binding
- GO:0030346 protein phosphatase 2B binding
- GO:0036487 nitric-oxide synthase inhibitor activity
Page 1 of 2
Biological Process (3)
KEGG (9)
- hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04961 Endocrine and other factor-regulated calcium reabsorption
- KEGG:hsa04970 Salivary secretion
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa04978 Mineral absorption
Reactome (10)
- R-hsa-5576891 cardiac conduction
- R-hsa-109582 hemostasis
- R-hsa-983712 ion channel transport
- R-hsa-5578775 ion homeostasis
- R-hsa-936837 ion transport by p type atpases
- R-hsa-397014 muscle contraction
- R-hsa-418360 platelet calcium homeostasis
- R-hsa-418346 platelet homeostasis
- R-hsa-418359 reduction of cytosolic ca levels
- R-hsa-382551 transport of small molecules
Canonical Pathways (3)
- M20 Pid p38 mkk3 6pathway
- M269 Pid ras pathway
- M161 Pid ifng pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence52
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ATP2B4 | PTK2 | Q05397 | Y | 1,176 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORKEAPhosphoSite | SIGNOR:12540962KEA:12540962KEA:9182531 |
| ATP2B4 | SRC | P12931 | Y | 1,176 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:9182531KEA:12540962KEA:9182531HPRD:12540962 |
| ATP2B2 | PRKCA | P17252 | T | 1,094 | phosphorylation | KEA | KEA:1827443 |
Ligand-Receptor Signaling (44)
44 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| basolateral_cell_membrane | plasma_membrane | UniProt_location | |||||
| apical_cell_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| cell_surface | cell_surface | Surfaceome | |||||
| cell_surface | cell_surface | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FAK1 | Q05397 | AT2B4 | P23634 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEASIGNOR_ProtMapperPhosphoSite | PhosphoSite:12540962ProtMapper:12540962SIGNOR:12540962KEA:9182531PhosphoSite:25847233KEA:12540962 |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 37713494 |
Sequence, Structure & Domains
Sequences
Length
1,241
Mass
137,920
Sequence
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALLGFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRKCNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDTEPSWDNENEILTELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFLCLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFSCTSLSLSQWLWCLFIGIGELLWGQFISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEIDHAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVLRRQNMGQHLDVKLVPSSSYIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
Alternative Products
Event=Alternative splicing; Named isoforms=8; Comment=There is a combination of two alternatively spliced domains at N-terminal site A (X and Z) and at C-terminal site B/C (A, B, D and K). The splice sites have mostly been studied independently. Full isoforms so far detected are isoform XA and isoform XB. Experimental confirmation may be lacking for some isoforms.; Name=XD; Synonyms=AIICIV; IsoId=P23634-1; Sequence=Displayed; Name=XA; Synonyms=AIICII; IsoId=P23634-2; Sequence=VSP_000405; Name=ZA; Synonyms=AICII; IsoId=P23634-3; Sequence=VSP_000402, VSP_000405; Name=XK; Synonyms=XG; IsoId=P23634-4; Sequence=VSP_000403, VSP_000405; Name=ZK; Synonyms=ZG; IsoId=P23634-5; Sequence=VSP_000402, VSP_000403, VSP_000405; Name=XB; Synonyms=AIICI, hPMCA4b; IsoId=P23634-6; Sequence=VSP_000404; Name=ZB; Synonyms=AICI; IsoId=P23634-7; Sequence=VSP_000402, VSP_000404; Name=ZD; Synonyms=AICIV; IsoId=P23634-8; Sequence=VSP_000402
Alternative Sequence
301..312; Missing (in isoform ZA, isoform ZK, isoform ZB and isoform ZD); 1009..1044; Missing (in isoform XK and isoform ZK); 1104..1139; Missing (in isoform XB and isoform ZB); 1140..1241; IKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV -> VAVAPVKSSPTTSVPAVSSPPMGNQSGQSVP (in isoform XA, isoform XK, isoform ZA and isoform ZK)
3D Structural Models
Turn
1087..1089; 1090..1092
Helix
1093..1102
3D Structure
NMR spectroscopy (2)
Domain & Motif Annotations
Region
294..318; Disordered; 1086..1103; Calmodulin-binding subdomain A; 1104..1113; Calmodulin-binding subdomain B
Protein Families (2)
- Cation transport ATPase (P-type) (TC 3.A.3) family
- Type IIB subfamily
Sequence Similarities
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs (2)
Interaction Protein
ENSG00000198668
Interaction Count
1
Interaction Dataset
biogrid_opencell
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39940923 | NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles. | No related sentences available |