Protein detail

FCAR

Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)

Entry name FCAR	UniProt ID P24071	EVMP confidence score 0.53
Supporting publications (n) 1	Transmembrane count 1	Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteins

Basic Information

Protein Names

Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)

Protein Class (3)

CD markersPredicted intracellular proteinsPredicted membrane proteins

Protein Function (2)

CD markers
Predicted intracellular proteins

Transmembrane

228..246; Helical

Transmembrane Count

Ensembl

ENSG00000186431

Entrez Gene Symbol

FCAR

Gene Synonym (3)

CD89FcalphaRFcalphaRI

Gene Description

Fc alpha receptor

Chromosome

Position

54874235-54891420

Supporting publications (n)

EVMP confidence score

0.53

Fluorescence & Localization

Function & Pathway

Protein Function (2)

CD markers
Predicted intracellular proteins

Cellular Component (5)

Molecular Function (2)

Biological Process (3)

KEGG (2)

Reactome (2)

Canonical Pathways

M145 Pid p53 downstream pathway

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence40

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
FCAR	GSK3B	P49841	S	284	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (32)

32 records.

Category	Parent	Database	Secreted	Plasma Membrane (Transmembrane)
transmembrane	transmembrane	UniProt_topology	Yes	Yes
transmembrane	transmembrane	UniProt_keyword	Yes	Yes
transmembrane_predicted	transmembrane	OmniPath	Yes	Yes
transmembrane	transmembrane	TopDB	Yes	Yes
transmembrane	transmembrane	LOCATE	Yes	Yes
transmembrane	transmembrane	Ramilowski_location	Yes	Yes
transmembrane	transmembrane	OmniPath	Yes	Yes
plasma_membrane	plasma_membrane	Cellinker	Yes	Yes
plasma_membrane	plasma_membrane	OmniPath	Yes	Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	Yes	Yes

Page 2 of 4Previous Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
GSK3A	P49840	FCAR	P24071	Yes		Yes	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:30766540 SIGNOR:30766540
PP2AA	P67775	FCAR	P24071	Yes	Yes		HPRDSIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:30766540 SIGNOR:30766540 HPRD:18768864
GSK3B	P49841	FCAR	P24071	Yes		Yes	SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:30766540 PhosphoSite:30766540 SIGNOR:30766540

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
FCAR IGHA1 JCHAIN PIGR	P01591 P01833 P01876 P24071	1:1:4:2	PDB	PDB:8sku
FCAR IGHA1	P01876 P24071	2:2	PDB	PDB:1ow0
FCAR	P24071	2	PDB	PDB:1ovz

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	38207106

Sequence, Structure & Domains

Sequences

Length

287

Mass

32,265

Sequence

MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK

Alternative Products

Event=Alternative splicing; Named isoforms=11; Comment=Additional isoforms seem to exist.; Name=A.1; IsoId=P24071-1; Sequence=Displayed; Name=A.2; IsoId=P24071-2; Sequence=VSP_002635; Name=A.3; Synonyms=RLA2; IsoId=P24071-3; Sequence=VSP_002634; Name=B; IsoId=P24071-4; Sequence=VSP_002636; Name=B-delta-S2; IsoId=P24071-5; Sequence=VSP_002632, VSP_002636; Name=U02; IsoId=P24071-6; Sequence=VSP_002633, VSP_002635; Name=L10; IsoId=P24071-7; Sequence=VSP_002632, VSP_043565; Name=U09; IsoId=P24071-8; Sequence=VSP_002632, VSP_043567; Name=U10; IsoId=P24071-9; Sequence=VSP_002632, VSP_043566; Name=U11; IsoId=P24071-10; Sequence=VSP_002632; Name=U13; IsoId=P24071-11; Sequence=VSP_002632, VSP_002635

Alternative Sequence

12..23; Missing (in isoform B-delta-S2, isoform L10, isoform U09, isoform U10, isoform U11 and isoform U13); 24..120; Missing (in isoform L10); 24; G -> GRYISEHFWCRSLGCNPVNDASAQRPG (in isoform U02); 115..210; Missing (in isoform U10); 121..216; Missing (in isoform A.3); 193..287; CYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK -> LHPPRLHDAELDPHGRGRTGPRGSLGHTG (in isoform U09); 195..216; Missing (in isoform A.2, isoform U02 and isoform U13); 217..287; DSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK -> GRYRPVQPCVWVGCPGPCHRAGI (in isoform B and isoform B-delta-S2)

3D Structural Models

Turn

105..107

Helix

23..25; 92..94; 185..187

Beta Strand

31..35; 37..40; 45..49; 56..64; 67..70; 72..74; 77..79; 84..87; 96..104; 108..111; 115..120; 127..132; 134..136; 143..147; 149..151; 154..160; 168..171; 173..179; 189..196; 198..200; 211..215

3D Structure

Electron microscopy (1); X-ray crystallography (3)

Domain & Motif Annotations

Domain (FT)

42..107; Ig-like C2-type 1; 139..200; Ig-like C2-type 2

Clinical Relevance

Related Diseases

Diabetes mellitus

Biomarker

Discontinued in Phase 1/2

Drug Targets

Discontinued target

Drugs (12)

SLC4101431 COMPOUND 49 [PMID: 30889352]COMPOUND 60 [PMID: 30889352]COMPOUND 27D [PMID: 28231433]COMPOUND 28 [PMID: 35439002]SKI II PF-543 MP-A08 COMPOUND 55 [PMID: 30889352]SLM6071469 COMPOUND 59 [PMID: 30889352]SK1-I

Antibody

HPA014050

Supporting Publications1

PMID	Title	Related sentences
28240915	Quantitative Proteomic Analysis of Serum Exosomes from Patients with Locally Advanced Pancreatic Cancer Undergoing Chemoradiotherapy.	No related sentences available