Protein detail
FCAR
Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)
Entry name FCAR | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)
Protein Class (3)
CD markersPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Transmembrane
228..246; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CD89FcalphaRFcalphaRI
Gene Description
Fc alpha receptor
Chromosome
19
Position
54874235-54891420
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization1
Function & Pathway8
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (2)
Biological Process (3)
Canonical Pathways
M145 Pid p53 downstream pathway
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence40
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FCAR | GSK3B | P49841 | S | 284 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| GSK3A | P49840 | FCAR | P24071 | Yes | No | Yes | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:30766540SIGNOR:30766540 |
| PP2AA | P67775 | FCAR | P24071 | Yes | Yes | No | HPRDSIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:30766540SIGNOR:30766540HPRD:18768864 |
| GSK3B | P49841 | FCAR | P24071 | Yes | No | Yes | SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:30766540PhosphoSite:30766540SIGNOR:30766540 |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38207106 |
Sequence, Structure & Domains10
Sequences
Length
287
Mass
32,265
Sequence
MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
Alternative Products
Event=Alternative splicing; Named isoforms=11; Comment=Additional isoforms seem to exist.; Name=A.1; IsoId=P24071-1; Sequence=Displayed; Name=A.2; IsoId=P24071-2; Sequence=VSP_002635; Name=A.3; Synonyms=RLA2; IsoId=P24071-3; Sequence=VSP_002634; Name=B; IsoId=P24071-4; Sequence=VSP_002636; Name=B-delta-S2; IsoId=P24071-5; Sequence=VSP_002632, VSP_002636; Name=U02; IsoId=P24071-6; Sequence=VSP_002633, VSP_002635; Name=L10; IsoId=P24071-7; Sequence=VSP_002632, VSP_043565; Name=U09; IsoId=P24071-8; Sequence=VSP_002632, VSP_043567; Name=U10; IsoId=P24071-9; Sequence=VSP_002632, VSP_043566; Name=U11; IsoId=P24071-10; Sequence=VSP_002632; Name=U13; IsoId=P24071-11; Sequence=VSP_002632, VSP_002635
Alternative Sequence
12..23; Missing (in isoform B-delta-S2, isoform L10, isoform U09, isoform U10, isoform U11 and isoform U13); 24..120; Missing (in isoform L10); 24; G -> GRYISEHFWCRSLGCNPVNDASAQRPG (in isoform U02); 115..210; Missing (in isoform U10); 121..216; Missing (in isoform A.3); 193..287; CYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK -> LHPPRLHDAELDPHGRGRTGPRGSLGHTG (in isoform U09); 195..216; Missing (in isoform A.2, isoform U02 and isoform U13); 217..287; DSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK -> GRYRPVQPCVWVGCPGPCHRAGI (in isoform B and isoform B-delta-S2)
3D Structural Models
Turn
105..107
Helix
23..25; 92..94; 185..187
Beta Strand
31..35; 37..40; 45..49; 56..64; 67..70; 72..74; 77..79; 84..87; 96..104; 108..111; 115..120; 127..132; 134..136; 143..147; 149..151; 154..160; 168..171; 173..179; 189..196; 198..200; 211..215
3D Structure
Electron microscopy (1); X-ray crystallography (3)
Domain & Motif Annotations
Domain (FT)
42..107; Ig-like C2-type 1; 139..200; Ig-like C2-type 2
Clinical Relevance5
Related Diseases
Biomarker
Discontinued in Phase 1/2
Drug Targets
Discontinued target
Drugs (12)
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 28240915 | Quantitative Proteomic Analysis of Serum Exosomes from Patients with Locally Advanced Pancreatic Cancer Undergoing Chemoradiotherapy. | No abstract available |