Protein detail
EDNRA
Endothelin-1 receptor (Endothelin receptor type A) (ET-A) (ETA-R) (hET-AR)
Protein symbol EDNRA | UniProt ID | EVMP score 0.63 |
Frequency 9 | Transmembrane count 7 | Protein classification Disease related genesFDA approved drug targetsG-protein coupled receptorsHuman disease related genesPredicted membrane proteins |
Basic Information
Protein Names
Endothelin-1 receptor (Endothelin receptor type A) (ET-A) (ETA-R) (hET-AR)
Protein Class
Disease related genesFDA approved drug targetsG-protein coupled receptorsHuman disease related genesPredicted membrane proteins
Protein Function
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Congenital malformations:Congenital malformations of face and neck
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
81..102; Helical; Name=1; 113..132; Helical; Name=2; 160..181; Helical; Name=3; 206..229; Helical; Name=4; 257..278; Helical; Name=5; 307..328; Helical; Name=6; 348..372; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
ET-AETA-RhET-AR
Gene Description
Endothelin receptor type A
Chromosome
4
Position
147480917-147544954
Frequency
9
EVMP Score
0.63
Fluorescence & Localization
Tissue Specificadipose tissueCell SpecificAdipocytesSingle-Nuclei Brain SpecificBergmann gliaBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Congenital malformations:Congenital malformations of face and neck
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function
Biological Process
KEGG
Reactome
Canonical Pathways
M169 Pid integrin2 pathway
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| EDNRA | GRK2 | P25098 | S | 391 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | S | 393 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | S | 397 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | T | 396 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | S | 404 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | T | 403 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
Regulatory Interaction Network
14 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EDN1 | P05305 | EDNRA | P25101 | Yes | Yes | No | iTALKKirouac2010Guide2Pharma_LRdbICELLNETSIGNORHINTLit-BM-17HPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrscConnectHPRDCui2007Ramilowski2015_Baccin2019Guide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020SPIKE_LCLRdb | Cellinker:10770212HINT:23597562connectomeDB2020:7647976CellTalkDB:7647976HINT:7509919ICELLNET:15629009connectomeDB2020:10770212HPRD:10770212Lit-BM-17:23597562Cellinker:7647976SIGNOR:16597412HINT:36882417ICELLNET:8440682connectomeDB2020:9082970Baccin2019:6479761Cellinker:9082970HPMR:9082970Baccin2019:90829707Lit-BM-17:7509919LRdb:9082970LRdb:10770212LRdb:7647976SPIKE_LC:16713569scConnect:7647976Guide2Pharma:7647976 |
| EDNRA | P25101 | GNAI3 | P08754 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNAI1 | P63096 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNAL | P38405 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNAQ | P50148 | Yes | Yes | No | WangSIGNOR | SIGNOR:15475516SIGNOR:31160049 |
| EDNRA | P25101 | GNAS3 | O95467 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | ALEX | P84996 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNAS2 | P63092 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNAS1 | Q5JWF2 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Page 1 of 2Next
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
427
Mass
48,722
Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P25101-1; Sequence=Displayed; Name=2; Synonyms=Delta-3; IsoId=P25101-2; Sequence=VSP_011059, VSP_011060; Name=3; Synonyms=Delta-4; IsoId=P25101-3; Sequence=VSP_011062, VSP_011063; Name=4; Synonyms=Delta-3,4; IsoId=P25101-4; Sequence=VSP_011061; Name=5; IsoId=P25101-5; Sequence=VSP_045578
Alternative Sequence
1..225; Missing (in isoform 5); 141..249; Missing (in isoform 4); 141..161; LLAGRWPFDHNDFGVFLCKLF -> VQSSCLLESCSGNWDSFGNCH (in isoform 2); 162..427; Missing (in isoform 2); 183..187; RYRAV -> SSTKM (in isoform 3); 188..427; Missing (in isoform 3)
3D Structural Models
Turn
147..150
Helix
77..107; 114..142; 152..187; 200..215; 218..221; 246..253; 256..283; 294..331; 340..359; 360..362; 364..370; 376..381
Beta Strand
188..191; 225..227; 238..240
3D Structure
Electron microscopy (5)
Domain & Motif Annotations
Compositional Bias
408..427; Basic and acidic residues
Region
406..427; Disordered
Protein Families
- G-protein coupled receptor 1 family
- Endothelin receptor subfamily
- EDNRA sub-subfamily
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Clinical Relevance
Disease Involvement
Disease variantFDA approved drug targetsHypotrichosis
Related Diseases
Anxiety disorderCardiac arrhythmiaCardiovascular diseaseCerebrovascular diseaseChronic kidney diseaseCoronary vasospastic diseaseDepressionHeart diseaseHypertensionHypotensionIncreased intracranial pressureMyocardial infarctionPreterm labour/deliveryProstate cancerPulmonary hypertensionRetinal vascular occlusionSolid tumour/cancerUnspecific body region injuryUrinary system clinical sympton
Biomarker
Discontinued in Phase 1; Discontinued in Phase 2; Approved; Phase 3; Terminated; Phase 2; Phase 1; Investigative; Discontinued in Phase 3
Drug Targets
FDA approved drug targets
Drugs