Protein detail
EDNRA
Endothelin-1 receptor (Endothelin receptor type A) (ET-A) (ETA-R) (hET-AR)
Entry name EDNRA | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 9 | Transmembrane count 7 | Protein classification Disease related genesFDA approved drug targetsG-protein coupled receptorsHuman disease related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Endothelin-1 receptor (Endothelin receptor type A) (ET-A) (ETA-R) (hET-AR)
Protein Class (5)
Disease related genesFDA approved drug targetsG-protein coupled receptorsHuman disease related genesPredicted membrane proteins
Protein Function (4)
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Congenital malformations:Congenital malformations of face and neck
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
81..102; Helical; Name=1; 113..132; Helical; Name=2; 160..181; Helical; Name=3; 206..229; Helical; Name=4; 257..278; Helical; Name=5; 307..328; Helical; Name=6; 348..372; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ET-AETA-RhET-AR
Gene Description
Endothelin receptor type A
Chromosome
4
Position
147480917-147544954
Supporting publications (n)
9
EVMP confidence score
0.63
Fluorescence & Localization6
Tissue Specificadipose tissueCell SpecificAdipocytesSingle-Nuclei Brain SpecificBergmann gliaBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway8
Protein Function (4)
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Congenital malformations:Congenital malformations of face and neck
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function (3)
Biological Process (3)
KEGG (7)
Reactome (5)
Canonical Pathways
M169 Pid integrin2 pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence85
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| EDNRA | GRK2 | P25098 | S | 391 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | S | 393 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | S | 397 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | T | 396 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | S | 404 | phosphorylation | PhosphoSite | |
| EDNRA | GRK2 | P25098 | T | 403 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (63)
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| endothelin | receptor | HGNC | No | Yes | No | Yes | No |
| receptor | receptor | HGNC | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 7 of 7Previous
Regulatory Interaction Network (14)
14 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EDNRA | P25101 | GNAZ | P19086 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| EDNRA | P25101 | GNA13 | Q14344 | Yes | Yes | No | SIGNOR | SIGNOR:10199825 |
| EDNRA | P25101 | GNA14 | O95837 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| ARBK1 | P25098 | EDNRA | P25101 | Yes | No | No | PhosphoSite_norefProtMapperWangPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:24064210PhosphoSite:14636059 |
Page 2 of 2Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains13
Sequences
Length
427
Mass
48,722
Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P25101-1; Sequence=Displayed; Name=2; Synonyms=Delta-3; IsoId=P25101-2; Sequence=VSP_011059, VSP_011060; Name=3; Synonyms=Delta-4; IsoId=P25101-3; Sequence=VSP_011062, VSP_011063; Name=4; Synonyms=Delta-3,4; IsoId=P25101-4; Sequence=VSP_011061; Name=5; IsoId=P25101-5; Sequence=VSP_045578
Alternative Sequence
1..225; Missing (in isoform 5); 141..249; Missing (in isoform 4); 141..161; LLAGRWPFDHNDFGVFLCKLF -> VQSSCLLESCSGNWDSFGNCH (in isoform 2); 162..427; Missing (in isoform 2); 183..187; RYRAV -> SSTKM (in isoform 3); 188..427; Missing (in isoform 3)
3D Structural Models
Turn
147..150
Helix
77..107; 114..142; 152..187; 200..215; 218..221; 246..253; 256..283; 294..331; 340..359; 360..362; 364..370; 376..381
Beta Strand
188..191; 225..227; 238..240
3D Structure
Electron microscopy (5)
Domain & Motif Annotations
Compositional Bias
408..427; Basic and acidic residues
Region
406..427; Disordered
Protein Families (3)
- G-protein coupled receptor 1 family
- Endothelin receptor subfamily
- EDNRA sub-subfamily
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Clinical Relevance6
Disease Involvement (3)
Disease variantFDA approved drug targetsHypotrichosis
Related Diseases (19)
Anxiety disorderCardiac arrhythmiaCardiovascular diseaseCerebrovascular diseaseChronic kidney diseaseCoronary vasospastic diseaseDepressionHeart diseaseHypertensionHypotensionIncreased intracranial pressureMyocardial infarctionPreterm labour/deliveryProstate cancerPulmonary hypertensionRetinal vascular occlusionSolid tumour/cancerUnspecific body region injuryUrinary system clinical sympton
Biomarker
Discontinued in Phase 1; Discontinued in Phase 2; Approved; Phase 3; Terminated; Phase 2; Phase 1; Investigative; Discontinued in Phase 3
Drug Targets
FDA approved drug targets
Drugs (23)
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No abstract available |
| 30975894 | Use of extracellular vesicles from lymphatic drainage as surrogate markers of melanoma progression and BRAF V600E mutation. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 36406491 | Automated Proteomics Sample Preparation of Phosphatidylserine-Positive Extracellular Vesicles from Human Body Fluids. | No abstract available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 38612515 | Proteomic Analysis of Salivary Extracellular Vesicles from COVID-19 Patients Reveals a Specific Anti-COVID-19 Response Protein Signature. | No abstract available |
| 39532703 | Proteomic Insights Into Gingival Crevicular Extracellular Vesicles in Periodontitis and Gestational Diabetes: An Exploratory Study. | No abstract available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No abstract available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No abstract available |