Protein detail

ACKR3

Atypical chemokine receptor 3 (C-X-C chemokine receptor type 7) (CXC-R7) (CXCR-7) (Chemokine orphan receptor 1) (G-protein coupled receptor 159) (G-protein coupled receptor RDC1 homolog) (RDC-1)

Protein symbol ACKR3	UniProt ID P25106	EVMP score 0.50
Frequency 1	Transmembrane count 7	Protein classification Cancer-related genesDisease related genesG-protein coupled receptorsPotential drug targetsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Atypical chemokine receptor 3 (C-X-C chemokine receptor type 7) (CXC-R7) (CXCR-7) (Chemokine orphan receptor 1) (G-protein coupled receptor 159) (G-protein coupled receptor RDC1 homolog) (RDC-1)

Protein Class

Cancer-related genesDisease related genesG-protein coupled receptorsPotential drug targetsPredicted membrane proteins

Protein Function

Potential drug targets
G-protein coupled receptors:GPCRs excl olfactory receptors
G-protein coupled receptors:Chemokines and chemotactic factors receptors
Disease related genes
Cancer-related genes

Transmembrane

41..61; Helical; Name=1; 82..102; Helical; Name=2; 119..139; Helical; Name=3; 163..183; Helical; Name=4; 214..234; Helical; Name=5; 253..273; Helical; Name=6; 297..319; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000144476

Entrez Gene Symbol

ACKR3

Gene Synonym

CMKOR1CXCR7GPR159RDC1

Gene Description

Atypical chemokine receptor 3

Chromosome

Position

236567787-236582354

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificDecidual stromal cellsBlood Lineage Specificdendritic cells

Function & Pathway

Protein Function

Potential drug targets
G-protein coupled receptors:GPCRs excl olfactory receptors
G-protein coupled receptors:Chemokines and chemotactic factors receptors
Disease related genes
Cancer-related genes

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

68 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellChatDB	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	Guide2Pharma	No	Yes	No	Yes	No
gpcr	receptor	DGIdb	No	Yes	No	Yes	No

Page 1 of 7Next

Regulatory Interaction Network

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
SDF1	P48061	ACKR3	P25106	Yes	Yes	No	iTALKGuide2Pharma_LRdbICELLNETSIGNORHINTHPMR_talklrHPMRCellChatDBtalklrscConnectGuide2Pharma_CellinkerRamilowski2015HPMR_LRdbGuide2Pharma_talklrBaccin2019CellinkerSTRING_talklrEMBRACEGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	scConnect:23396314 connectomeDB2020:23396314 LRdb:20956518 HPMR:16107333 LRdb:16107333 Guide2Pharma:23396314 LRdb:23396314 ICELLNET:24218476 CellTalkDB:16107333 scConnect:20956518 HINT:35857509 connectomeDB2020:20956518 connectomeDB2020:16107333 Cellinker:23396314 Cellinker:20956518 Baccin2019:16107333 ICELLNET:22633458 Cellinker:16107333 Guide2Pharma:20956518 SIGNOR:16107333 ICELLNET:20161793
CXL11	O14625	ACKR3	P25106	Yes	Yes	No	Guide2PharmaCellChatDBCellTalkDBFantom5_LRdbiTALKCellPhoneDBscConnecttalklrGuide2Pharma_LRdbICELLNETSIGNORconnectomeDB2020Guide2Pharma_talklrLRdbRamilowski2015	ICELLNET:22633458 connectomeDB2020:27875312 SIGNOR:16940167 connectomeDB2020:29180449 CellTalkDB:27875312 ICELLNET:24218476 connectomeDB2020:29386406 ICELLNET:20161793

Protein Complex Composition

5 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ACKR3 ATP5F1D ATP5F1E ATP5MF ATP5PF HTR1E	P18859 P25106 P28566 P30049 P56134 P56381	0:0:0:0:0:0	hu.MAP
ACKR3 ATP5F1D ATP5F1E ATP5MF ATP5PF	P18859 P25106 P30049 P56134 P56381	0:0:0:0:0	hu.MAP
ACKR3 GJB2	P25106 P29033	0:0	hu.MAPhu.MAP2
ACKR3 ATP5F1D ATP5MF	P25106 P30049 P56134	0:0:0	hu.MAP
ACKR3 CXCL12	P25106 P48061	1:1	PDB	PDB:7sk8PDB:7sk6PDB:7sk3PDB:7sk4PDB:7sk7PDB:7sk5

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass spectrometry	1	32384937

Sequence, Structure & Domains

Sequences

Length

362

Mass

41,493

Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

3D Structural Models

Turn

189..191; 202..204; 218..221; 316..318

Helix

40..75; 81..95; 97..105; 114..147; 149..151; 154..181; 205..217; 222..241; 245..248; 252..279; 287..315; 320..330

Beta Strand

31..33; 183..187; 194..198; 353..356

3D Structure

Electron microscopy (13); X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

The C-terminal cytoplasmic tail, plays a key role in: correct trafficking to the cell membrane, recruitment of beta-arrestin, ubiquitination, and in chemokine scavenging and signaling functions. The Ser/Thr residues and the Lys residues in the C-terminal cytoplasmic tail are essential for beta-arrestin recruitment and ubiquitination respectively.

Region

324..362; C-terminal cytoplasmic tail

Protein Families

G-protein coupled receptor 1 family
Atypical chemokine receptor subfamily

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family. Atypical chemokine receptor subfamily.

Clinical Relevance

Disease Involvement

Cancer-related genesDisease variant

Related Diseases

Asthma Solid tumour/cancer

Biomarker

Discontinued in Phase 2; Preclinical

Antibody

HPA032003 HPA049718