Protein detail
ACKR3
Atypical chemokine receptor 3 (C-X-C chemokine receptor type 7) (CXC-R7) (CXCR-7) (Chemokine orphan receptor 1) (G-protein coupled receptor 159) (G-protein coupled receptor RDC1 homolog) (RDC-1)
Entry name ACKR3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification Cancer-related genesDisease related genesG-protein coupled receptorsPotential drug targetsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Atypical chemokine receptor 3 (C-X-C chemokine receptor type 7) (CXC-R7) (CXCR-7) (Chemokine orphan receptor 1) (G-protein coupled receptor 159) (G-protein coupled receptor RDC1 homolog) (RDC-1)
Protein Class (5)
Cancer-related genesDisease related genesG-protein coupled receptorsPotential drug targetsPredicted membrane proteins
Protein Function (5)
- Potential drug targets
- G-protein coupled receptors:GPCRs excl olfactory receptors
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Disease related genes
- Cancer-related genes
Transmembrane
41..61; Helical; Name=1; 82..102; Helical; Name=2; 119..139; Helical; Name=3; 163..183; Helical; Name=4; 214..234; Helical; Name=5; 253..273; Helical; Name=6; 297..319; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CMKOR1CXCR7GPR159RDC1
Gene Description
Atypical chemokine receptor 3
Chromosome
2
Position
236567787-236582354
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Cell SpecificDecidual stromal cellsBlood Lineage Specificdendritic cells
Function & Pathway7
Protein Function (5)
- Potential drug targets
- G-protein coupled receptors:GPCRs excl olfactory receptors
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Disease related genes
- Cancer-related genes
Cellular Component (8)
Molecular Function (7)
Biological Process (3)
KEGG (2)
Reactome (6)
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence76
Ligand-Receptor Signaling (68)
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cytokine | receptor | iTALK | No | Yes | No | Yes | No |
| receptor | receptor | Almen2009 | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| receptor | receptor | EMBRACE | No | Yes | No | Yes | No |
| gpcr | receptor | GPCRdb | No | Yes | No | Yes | No |
| atypical_chemokine | receptor | HGNC | No | Yes | No | Yes | No |
| receptor | receptor | HGNC | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 7 of 7Previous
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SDF1 | P48061 | ACKR3 | P25106 | Yes | Yes | No | iTALKGuide2Pharma_LRdbICELLNETSIGNORHINTHPMR_talklrHPMRCellChatDBtalklrscConnectGuide2Pharma_CellinkerRamilowski2015HPMR_LRdbGuide2Pharma_talklrBaccin2019CellinkerSTRING_talklrEMBRACEGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | scConnect:23396314connectomeDB2020:23396314LRdb:20956518HPMR:16107333LRdb:16107333Guide2Pharma:23396314LRdb:23396314ICELLNET:24218476CellTalkDB:16107333scConnect:20956518HINT:35857509connectomeDB2020:20956518connectomeDB2020:16107333Cellinker:23396314Cellinker:20956518Baccin2019:16107333ICELLNET:22633458Cellinker:16107333Guide2Pharma:20956518SIGNOR:16107333ICELLNET:20161793 |
| CXL11 | O14625 | ACKR3 | P25106 | Yes | Yes | No | Guide2PharmaCellChatDBCellTalkDBFantom5_LRdbiTALKCellPhoneDBscConnecttalklrGuide2Pharma_LRdbICELLNETSIGNORconnectomeDB2020Guide2Pharma_talklrLRdbRamilowski2015 | ICELLNET:22633458connectomeDB2020:27875312SIGNOR:16940167connectomeDB2020:29180449CellTalkDB:27875312ICELLNET:24218476connectomeDB2020:29386406ICELLNET:20161793 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ACKR3ATP5F1DATP5F1EATP5MFATP5PFHTR1E | P18859P25106P28566P30049P56134P56381 | 0:0:0:0:0:0 | hu.MAP | |||
| ACKR3ATP5F1DATP5F1EATP5MFATP5PF | P18859P25106P30049P56134P56381 | 0:0:0:0:0 | hu.MAP | |||
| ACKR3GJB2 | P25106P29033 | 0:0 | hu.MAPhu.MAP2 | |||
| ACKR3ATP5F1DATP5MF | P25106P30049P56134 | 0:0:0 | hu.MAP | |||
| ACKR3CXCL12 | P25106P48061 | 1:1 | PDB | PDB:7sk8PDB:7sk6PDB:7sk3PDB:7sk4PDB:7sk7PDB:7sk5 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains11
Sequences
Length
362
Mass
41,493
Sequence
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
3D Structural Models
Turn
189..191; 202..204; 218..221; 316..318
Helix
40..75; 81..95; 97..105; 114..147; 149..151; 154..181; 205..217; 222..241; 245..248; 252..279; 287..315; 320..330
Beta Strand
31..33; 183..187; 194..198; 353..356
3D Structure
Electron microscopy (13); X-ray crystallography (1)
Domain & Motif Annotations
Domain (CC)
The C-terminal cytoplasmic tail, plays a key role in: correct trafficking to the cell membrane, recruitment of beta-arrestin, ubiquitination, and in chemokine scavenging and signaling functions. The Ser/Thr residues and the Lys residues in the C-terminal cytoplasmic tail are essential for beta-arrestin recruitment and ubiquitination respectively.
Region
324..362; C-terminal cytoplasmic tail
Protein Families (2)
- G-protein coupled receptor 1 family
- Atypical chemokine receptor subfamily
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family. Atypical chemokine receptor subfamily.
Clinical Relevance4
Disease Involvement (2)
Cancer-related genesDisease variant
Related Diseases (2)
Biomarker
Discontinued in Phase 2; Preclinical
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |