Protein detail
NPY1R
Neuropeptide Y receptor type 1 (NPY1-R)
Entry name NPY1R | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neuropeptide Y receptor type 1 (NPY1-R)
Protein Function (2)
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
45..65; Helical; Name=1; 77..97; Helical; Name=2; 117..137; Helical; Name=3; 155..175; Helical; Name=4; 212..232; Helical; Name=5; 261..281; Helical; Name=6; 300..320; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificBreast secretory cells
Function & Pathway
Protein Function (2)
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (2)
Molecular Function (6)
Biological Process (3)
KEGG (3)
Reactome (5)
Mediation Categories (2)
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence57
Ligand-Receptor Signaling (55)
55 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | Yes | Yes | |||
| receptor | receptor | HPMR | Yes | Yes | |||
| receptor | receptor | CellChatDB | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Surfaceome | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| receptor | receptor | Guide2Pharma | Yes | Yes | |||
| gpcr | receptor | DGIdb | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| receptor | receptor | Baccin2019 | Yes | Yes |
Page 1 of 6Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| NPY | P01303 | NPY1R | P25929 | Yes | Yes | iTALKSIGNORHINTLit-BM-17HPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrscConnectHPRDRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020SPIKE_LCLRdb | Cellinker:9549761connectomeDB2020:7559383LRdb:7559383Cellinker:12007534LRdb:12007534connectomeDB2020:12007534Lit-BM-17:23597562HPMR:9549761Lit-BM-17:7559383Baccin2019:9549761HINT:35507650HINT:7559383CellTalkDB:9001438connectomeDB2020:9001438HPRD:7559383Cellinker:7559383HPRD:12007534Cellinker:9001438LRdb:9549761SIGNOR:9549761HINT:12007534Baccin2019:7559383connectomeDB2020:9549761Baccin2019:12007534LRdb:9001438HPRD:9001438HINT:9001438Baccin2019:9001438SPIKE_LC:16189514 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blottingImmunofluorescence | 1 | 38795909 |
Sequence, Structure & Domains
Sequences
Length
384
Mass
44,392
Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
3D Structural Models
Turn
31..34; 145..147
Helix
22..24; 37..67; 74..92; 94..103; 110..142; 152..176; 182..184; 205..219; 221..240; 241..244; 259..288; 296..321; 325..334
Beta Strand
177..180; 185..188; 197..200; 292..294
3D Structure
Electron microscopy (4); X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (5)
Biomarker
Terminated; Discontinued in Phase 2; Preclinical
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27487081 | Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation. | No related sentences available |