Protein detail

TNR5

Tumor necrosis factor receptor superfamily member 5 (B-cell surface antigen CD40) (Bp50) (CD40L receptor) (CDw40) (CD antigen CD40)

Entry name TNR5	UniProt ID P25942	EVMP confidence score 0.38
Supporting publications (n) 5	Transmembrane count 1	Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted membrane proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Tumor necrosis factor receptor superfamily member 5 (B-cell surface antigen CD40) (Bp50) (CD40L receptor) (CDw40) (CD antigen CD40)

Protein Class (6)

Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted membrane proteinsPredicted secreted proteins

Protein Function (5)

CD markers
Human disease related genes:Immune system diseases:Primary immunodeficiency
Cancer-related genes:Candidate cancer biomarkers
Predicted secreted proteins
Disease related genes

Transmembrane

194..215; Helical

Transmembrane Count

Ensembl

ENSG00000101017

Entrez Gene Symbol

CD40

Gene Synonym (3)

Bp50p50TNFRSF5

Gene Description

CD40 molecule

Chromosome

Position

46118271-46129863

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Tissue SpecificesophagusCell SpecificEnterocytesSingle-Nuclei Brain Specificastrocyte

Function & Pathway7

Protein Function (5)

CD markers
Human disease related genes:Immune system diseases:Primary immunodeficiency
Cancer-related genes:Candidate cancer biomarkers
Predicted secreted proteins
Disease related genes

Cellular Component (8)

Molecular Function (6)

Biological Process (3)

KEGG (17)

Page 1 of 2

Reactome (5)

Mediation Categories (5)

Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence76

Ligand-Receptor Signaling (63)

63 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	scConnect	No	Yes	Yes	Yes	No
receptor	receptor	connectomeDB2020	No	Yes	Yes	Yes	No
receptor	receptor	CellCall	No	Yes	Yes	Yes	No
receptor	receptor	iTALK	No	Yes	Yes	Yes	No
receptor	receptor	Almen2009	No	Yes	Yes	Yes	No
receptor	receptor	CellCellInteractions	No	Yes	Yes	Yes	No
receptor	receptor	EMBRACE	No	Yes	Yes	Yes	No
tumor_necrosis_factor	receptor	HGNC	No	Yes	Yes	Yes	No
receptor	receptor	HGNC	No	Yes	Yes	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	Yes	Yes	No

Page 6 of 7Previous Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CD40L	P29965	TNR5	P25942	Yes	Yes	No	iTALKKEGG-MEDICUSGuide2Pharma_LRdbICELLNETSIGNORHINTCellPhoneDB_CellinkerUniProt_LRdbDIPHPMR_talklrCellChatDBHPRD_LRdbDLRP_CellinkertalklrscConnectHPRDCui2007DLRP_talklrGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrCellinkerSTRING_talklrCellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020SPIKE_LCLRdbSPIKE	HINT:17567982 LRdb:10647992 LRdb:7516405 HPRD:7543281 SIGNOR:12324477 LRdb:1374165 SPIKE_LC:17183360 connectomeDB2020:7543281 DIP:1280226 connectomeDB2020:7516405 Cellinker:1374165 LRdb:7543281 HPRD:10647992 connectomeDB2020:1374165 Cellinker:7516405 SIGNOR:19426221 SPIKE:17183360 HPRD:7516405 Cellinker:10647992 ICELLNET:11163401 HINT:21285457 Cellinker:7543281 connectomeDB2020:10647992
TNR5	P25942	TRAF2	Q12933	Yes	Yes	No	WangLMPIDSIGNORHPRDHINTHuRIBioGRIDIntActInnateDBDIPSPIKE_LCLit-BM-17SPIKE	Lit-BM-17:20676093 HINT:10518213 Lit-BM-17:11562359 Lit-BM-17:9990007 HINT:20676093 LMPID:9718306 IntAct:32296183 SIGNOR:18635759 HINT:8855313 BioGRID:21071692 Lit-BM-17:12637493 InnateDB:12637493 HINT:10352240 HINT:25502805 HINT:9133417 HPRD:10411888 InnateDB:9718306 InnateDB:17332487 InnateDB:9168896 HINT:16282325 LMPID:10518213 Lit-BM-17:10428814 IntAct:25416956 Lit-BM-17:16260598 HINT:17332487 IntAct:31515488 Lit-BM-17:27716849 HINT:10318845 Lit-BM-17:17353931 HINT:20449947 HINT:17353931 Lit-BM-17:12220533 Lit-BM-17:10352240 InnateDB:10318845 HINT:9020361 InnateDB:16282325 Lit-BM-17:10411888 Lit-BM-17:20614026 InnateDB:9133417 Lit-BM-17:9020361 Lit-BM-17:19667091 SPIKE_LC:15485859 SPIKE:15485859 HINT:9718306 Lit-BM-17:9168896 SPIKE_LC:17353931 HINT:33961781 SPIKE:16713569 HPRD:16260598 IntAct:25502805 DIP:10428814 Lit-BM-17:9718306 IntAct:17353931 Lit-BM-17:21041727 SPIKE:17353931 HINT:12637493 HINT:25910212 InnateDB:20676093 Lit-BM-17:20449947 HINT:10411888 SPIKE_LC:16713569 IntAct:25910212 Lit-BM-17:21282461 HINT:9990007 InnateDB:8855313
TNR5	P25942	TRAF3	Q13114	Yes	Yes	Yes	WangSIGNORHPRDCui2007HINTBioGRIDInnateDBSPIKE_LCLit-BM-17SPIKE	HINT:7859281 HINT:10984535 HPRD:7527023 Lit-BM-17:11562359 Lit-BM-17:9990007 HINT:7530216 Lit-BM-17:14517219 SPIKE_LC:17145710 SIGNOR:18635759 BioGRID:10984535 SPIKE:17145710 Lit-BM-17:12637493 InnateDB:12637493 HINT:10352240 HINT:24810049 HPRD:10984535 HINT:7533327 InnateDB:9718306 HINT:9133417 HINT:24260396 InnateDB:17332487 InnateDB:9168896 Lit-BM-17:7859281 HINT:14517219 Lit-BM-17:10428814 HPRD:7533327 Lit-BM-17:16260598 HINT:17332487 Lit-BM-17:24260396 Lit-BM-17:27716849 HINT:10318845 SPIKE_LC:7527023 Lit-BM-17:24810049 SPIKE:7527023 Lit-BM-17:12220533 Lit-BM-17:10352240 InnateDB:10318845 Lit-BM-17:20614026 Lit-BM-17:17878343 InnateDB:9133417 Lit-BM-17:7527023 Lit-BM-17:19667091 SPIKE_LC:15485859 SPIKE:15485859 HINT:9718306 Lit-BM-17:7533327 Lit-BM-17:9168896 Lit-BM-17:9384571 HINT:7527023 HPRD:16260598 Lit-BM-17:21041727 Lit-BM-17:7530216 HINT:12637493 Lit-BM-17:10984535 Lit-BM-17:9718306 HPRD:7530216 HINT:9384571 HINT:9990007

Protein Complex Composition (9)

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Membrane-associated multicomponent signaling complexanti-CD40 stimulated (Cd40IkbkgMap3k1Traf2Ube2n)	CD40 IKBKG MAP3K1 TRAF2 UBE2N	P25942 P61088 Q12933 Q13233 Q9Y6K9	1:1:1:1:1	Compleat	Compleat:HC2242	18635759
Multicomponent signaling complexanti-CD40 stimulated(Birc2Birc3Cd40IkbkgMap3k1Traf2Ube2n)	BIRC2 BIRC3 CD40 IKBKG MAP3K1 TRAF2 UBE2N	P25942 P61088 Q12933 Q13233 Q13489 Q13490 Q9Y6K9	1:1:1:1:1:1:1	Compleat	Compleat:HC88	18635759
	CD40LG TNC	P24821 P29965	1:1	PDB	PDB:6brb
	CD40	P25942	3	PDB	PDB:5dmjPDB:7p3iPDB:5ihlPDB:8yx9PDB:6pe9PDB:6pe8PDB:8yx1
	CD40 CD40LG	P25942 P29965	4:6	PDB	PDB:3qd6
	CD40 TRAF2	P25942 Q12933	2:3	PDB	PDB:1czzPDB:1d00
	CD40 TRAF3	P25942 Q13114	2:2	PDB	PDB:1fll
	CD40 TRAF6	P25942 Q9Y4K3	1:1	PDB	PDB:1lb6
	CD40LG	P29965	3	CompleatCFinderPDB	PDB:7sgmPDB:1i9rPDB:6w9gPDB:3lkjCompleat:HC7674

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometryMORPH	1	22808001

Sequence, Structure & Domains11

Sequences

Length

277

Mass

30,619

Sequence

MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Alternative Products

Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist.; Name=I; IsoId=P25942-1; Sequence=Displayed; Name=II; IsoId=P25942-2; Sequence=VSP_006472, VSP_006473

Alternative Sequence

166..203; SCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFG -> RSPGSAESPGGDPHHLRDPVCHPLGAGLYQKGGQEANQ (in isoform II); 204..277; Missing (in isoform II)

3D Structural Models

Helix

85..87; 168..170

Beta Strand

30..33; 36..39; 45..49; 53..55; 58..61; 64..67; 70..72; 89..93; 97..99; 102..105; 109..113; 117..121; 129..133; 137..139; 142..145; 156..158; 173..176; 180..182; 185..187; 234..237; 258..260

3D Structure

X-ray crystallography (14)

Domain & Motif Annotations

Compositional Bias

264..277; Basic and acidic residues

Repeat

25..60; TNFR-Cys 1; 61..103; TNFR-Cys 2; 104..144; TNFR-Cys 3; 145..187; TNFR-Cys 4

Region

223..277; Disordered

Clinical Relevance8

Disease Involvement (2)

Cancer-related genesDisease variant

Related Diseases (16)

Brain cancer Crohn disease Diabetes mellitus Lupus erythematosus Mature B-cell leukaemia Melanoma Motor neuron disease Multiple sclerosis Myasthenia gravis Ovarian cancer Rheumatoid arthritis Sjogren syndrome Solid tumour/cancer Thrombocytopenia Thyrotoxicosis Transplant rejection

Biomarker

Phase 1; Phase 2; Investigative

Antibody (5)

CAB002495 HPA031567 HPA031568 CAB072868 CAB080468

Interaction Protein (4)

ENSG00000091317ENSG00000127191ENSG00000131323ENSG00000175104

Interaction Count

Interaction Dataset (2)

intact_biogrid_bioplexintact_biogrid

Supporting Publications5

PMID	Title	Abstract
26775013	Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers.	No abstract available
31320591	Exosomes regulate neurogenesis and circuit assembly.	No abstract available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
33905554	Proteomic analysis of extracellular vesicles identified PI3K pathway as a potential therapeutic target for cabazitaxel-resistant prostate cancer.	No abstract available
40928027	Familial Alzheimer's disease mutation identifies novel role of SORLA in release of neurotrophic exosomes.	No abstract available