Protein detail
ITA3
Integrin alpha-3 (CD49 antigen-like family member C) (FRP-2) (Galactoprotein B3) (GAPB3) (VLA-3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha-3 heavy chain; Integrin alpha-3 light chain]
Entry name ITA3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Integrin alpha-3 (CD49 antigen-like family member C) (FRP-2) (Galactoprotein B3) (GAPB3) (VLA-3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha-3 heavy chain; Integrin alpha-3 light chain]
Protein Class (6)
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Transmembrane
992..1014; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD49cGAP-B3MSK18VCA-2VLA3a
Gene Description
Integrin subunit alpha 3
Chromosome
17
Position
50055968-50090481
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization7
Tissue SpecificliverCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway8
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (19)
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0008305 integrin complex
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0016323 basolateral plasma membrane
- GO:0031527 filopodium membrane
- GO:0031594 neuromuscular junction
- GO:0034667 integrin alpha3-beta1 complex
- GO:0043235 receptor complex
Page 1 of 2
Molecular Function (9)
Biological Process (3)
KEGG (13)
- hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05222 Small cell lung cancer
Page 1 of 2
Reactome (10)
- R-hsa-210991 basigin interactions
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-1474244 extracellular matrix organization
- R-hsa-109582 hemostasis
- R-hsa-216083 integrin cell surface interactions
- R-hsa-3000157 laminin interactions
- R-hsa-8874081 met activates ptk2 signaling
- R-hsa-8875878 met promotes cell motility
- R-hsa-6806834 signaling by met
- R-hsa-9006934 signaling by receptor tyrosine kinases
Canonical Pathways (3)
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence65
Ligand-Receptor Signaling (64)
64 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| integrin | receptor | Integrins | No | Yes | No | Yes | No |
| integrin | receptor | UniProt_keyword | No | Yes | No | Yes | No |
Page 1 of 7Next
Sequence, Structure & Domains10
Sequences
Length
1,051
Mass
116,612
Sequence
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHGNGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Alpha-3A; IsoId=P26006-2; Sequence=Displayed; Name=2; Synonyms=Alpha-3B; IsoId=P26006-1; Sequence=VSP_002721
Alternative Sequence
1017..1051; GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY -> DFFKRTRYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDQYY (in isoform 2)
Domain & Motif Annotations
Repeat
38..103; FG-GAP 1; 110..171; FG-GAP 2; 185..235; FG-GAP 3; 236..292; FG-GAP 4; 293..354; FG-GAP 5; 356..411; FG-GAP 6; 415..477; FG-GAP 7
Motif
1017..1021; GFFKR motif
Region
855..889; Disordered; 1015..1021; Interaction with HPS5
Protein Families
Integrin alpha chain family
Sequence Similarities
Belongs to the integrin alpha chain family.
Clinical Relevance5
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No abstract available |