Protein detail
ITA3
Integrin alpha-3 (CD49 antigen-like family member C) (FRP-2) (Galactoprotein B3) (GAPB3) (VLA-3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha-3 heavy chain; Integrin alpha-3 light chain]
Entry name ITA3 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Integrin alpha-3 (CD49 antigen-like family member C) (FRP-2) (Galactoprotein B3) (GAPB3) (VLA-3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha-3 heavy chain; Integrin alpha-3 light chain]
Protein Class
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Transmembrane
992..1014; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD49cGAP-B3MSK18VCA-2VLA3a
Gene Description
Integrin subunit alpha 3
Chromosome
17
Position
50055968-50090481
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificliverCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway
Protein Function
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0008305 integrin complex
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0016323 basolateral plasma membrane
- GO:0031527 filopodium membrane
- GO:0031594 neuromuscular junction
- GO:0034667 integrin alpha3-beta1 complex
- GO:0043235 receptor complex
- GO:0045211 postsynaptic membrane
- GO:0048471 perinuclear region of cytoplasm
- GO:0048787 presynaptic active zone membrane
- GO:0060076 excitatory synapse
- GO:0070062 extracellular exosome
- GO:0071944 cell periphery
- GO:0097060 synaptic membrane
- GO:0098978 glutamatergic synapse
- GO:1990812 growth cone filopodium
Molecular Function
Biological Process
KEGG
- hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05222 Small cell lung cancer
- KEGG:hsa05410 Hypertrophic cardiomyopathy
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
- KEGG:hsa05414 Dilated cardiomyopathy
Reactome
- R-hsa-210991 basigin interactions
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-1474244 extracellular matrix organization
- R-hsa-109582 hemostasis
- R-hsa-216083 integrin cell surface interactions
- R-hsa-3000157 laminin interactions
- R-hsa-8874081 met activates ptk2 signaling
- R-hsa-8875878 met promotes cell motility
- R-hsa-6806834 signaling by met
- R-hsa-9006934 signaling by receptor tyrosine kinases
Canonical Pathways
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
64 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| matrix_adhesion | matrix_adhesion | OmniPath | No | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
1,051
Mass
116,612
Sequence
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHGNGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Alpha-3A; IsoId=P26006-2; Sequence=Displayed; Name=2; Synonyms=Alpha-3B; IsoId=P26006-1; Sequence=VSP_002721
Alternative Sequence
1017..1051; GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY -> DFFKRTRYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDQYY (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Repeat
38..103; FG-GAP 1; 110..171; FG-GAP 2; 185..235; FG-GAP 3; 236..292; FG-GAP 4; 293..354; FG-GAP 5; 356..411; FG-GAP 6; 415..477; FG-GAP 7
Motif
1017..1021; GFFKR motif
Region
855..889; Disordered; 1015..1021; Interaction with HPS5
Protein Families
Integrin alpha chain family
Sequence Similarities
Belongs to the integrin alpha chain family.