Protein detail

ITB8

Integrin beta-8

Entry name ITB8	UniProt ID P26012	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Cancer-related genesPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information12

Protein Names

Integrin beta-8

Protein Class (2)

Cancer-related genesPredicted membrane proteins

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Transmembrane

685..704; Helical

Transmembrane Count

Ensembl

ENSG00000105855

Entrez Gene Symbol

ITGB8

Gene Description

Integrin subunit beta 8

Chromosome

Position

20330702-20415754

Supporting publications (n)

EVMP confidence score

0.50

Function & Pathway7

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Cellular Component (6)

Molecular Function (3)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (7)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationImmune mediationReceptor-signaling mediation

Relations & Evidence64

Ligand-Receptor Signaling (58)

58 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No
integrin	receptor	Integrins	No	Yes	No	Yes	No
integrin	receptor	UniProt_keyword	No	Yes	No	Yes	No
integrins	receptor	HPMR	No	Yes	No	Yes	No

Page 1 of 6Next

Regulatory Interaction Network (4)

4 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ITB8	P26012	TGFB1	P01137	Yes	Yes	No	ELMHINTHPRDSignaLink3SPIKE_LC	ELM:31792290 HINT:36008481 ELM:22278742 ELM:28117447 HINT:31792290 SignaLink3:20870411 SPIKE_LC:16189514 ELM:12415008 SignaLink3:11970960 SignaLink3:23331499 ELM:31955848 ELM:25617764 HINT:33961781 ELM:27033701 HPRD:11970960 ELM:25383667
ITBP1	O14713	ITB8	P26012	Yes	No	Yes	SIGNOR	SIGNOR:19118207
DOK1	Q99704	ITB8	P26012	Yes	No	Yes	SIGNOR	SIGNOR:19118207
TLN1	Q9Y490	ITB8	P26012	Yes	Yes	No	WangSIGNOR	SIGNOR:19118207

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ITGB8 LMF1	P26012 Q96S06	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass spectrometry	1	32384937

Sequence, Structure & Domains13

Sequences

Length

769

Mass

85,632

Sequence

MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P26012-1; Sequence=Displayed; Name=2; IsoId=P26012-2; Sequence=VSP_056531

Alternative Sequence

1..135; Missing (in isoform 2)

3D Structural Models

Turn

197..199; 210..215; 315..319

Helix

157..159; 160..165; 166..168; 170..180; 204..208; 235..242; 256..265; 267..270; 292..297; 325..335; 348..353; 355..357; 373..384

Beta Strand

105..107; 117..124; 135..139; 147..154; 182..191; 223..232; 250..254; 274..283; 309..314; 337..343; 361..365; 390..393; 396..398; 400..406; 408..410; 412..414; 415..417; 419..421; 424..426; 428..435; 448..452; 459..462

3D Structure

Electron microscopy (9); X-ray crystallography (2)

Domain & Motif Annotations

Domain (CC)

The VWFA domain (or beta I domain) contains two cation-binding sites: the ligand-associated metal ion-binding site (LIMBS or SyMBS) and the metal ion-dependent adhesion site (MIDAS) (PubMed:31792290). Unlike in the other beta integrins, the cation-binding site adjacent MIDAS site (ADMIDAS) in ITGB8 is not functional due to the presence of two Asn residues instead of 2 Asp residues (PubMed:31792290). This domain is also part of the ligand-binding site (PubMed:31792290).

Domain (FT)

46..95; PSI; 146..384; VWFA; 471..495; I-EGF 1; 499..547; I-EGF 2; 548..584; I-EGF 3; 585..625; I-EGF 4

Protein Families

Integrin beta chain family

Sequence Similarities

Belongs to the integrin beta chain family.

Clinical Relevance5

Disease Involvement

Cancer-related genes

Related Diseases

Chronic kidney disease

Biomarker

Phase 1

Drugs

ABITUZUMAB

Antibody (2)

HPA027796 HPA027797

Supporting Publications1

PMID	Title	Abstract
38716512	Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics.	No abstract available