Protein detail
ITB8
Integrin beta-8
Entry name ITB8 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 1 | Protein classification Cancer-related genesPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Integrin beta-8
Protein Class
Cancer-related genesPredicted membrane proteins
Protein Function
Cancer-related genes:Candidate cancer biomarkers
Transmembrane
685..704; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
Integrin subunit beta 8
Chromosome
7
Position
20330702-20415754
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Function & Pathway
Protein Function
Cancer-related genes:Candidate cancer biomarkers
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05410 Hypertrophic cardiomyopathy
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
- KEGG:hsa05414 Dilated cardiomyopathy
Reactome
- R-hsa-1566948 elastic fibre formation
- R-hsa-1474244 extracellular matrix organization
- R-hsa-216083 integrin cell surface interactions
- R-hsa-2129379 molecules associated with elastic fibres
- R-hsa-9006936 signaling by tgfb family members
- R-hsa-170834 signaling by tgf beta receptor complex
- R-hsa-2173789 tgf beta receptor signaling activates smads
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
58 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| growth_factor | receptor | iTALK | No | Yes | No | Yes | No |
| receptor | receptor | Almen2009 | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| receptor | receptor | EMBRACE | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 6 of 6Previous
Regulatory Interaction Network
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ITB8 | P26012 | TGFB1 | P01137 | Yes | Yes | No | ELMHINTHPRDSignaLink3SPIKE_LC | ELM:31792290HINT:36008481ELM:22278742ELM:28117447HINT:31792290SignaLink3:20870411SPIKE_LC:16189514ELM:12415008SignaLink3:11970960SignaLink3:23331499ELM:31955848ELM:25617764HINT:33961781ELM:27033701HPRD:11970960ELM:25383667 |
| ITBP1 | O14713 | ITB8 | P26012 | Yes | No | Yes | SIGNOR | SIGNOR:19118207 |
| DOK1 | Q99704 | ITB8 | P26012 | Yes | No | Yes | SIGNOR | SIGNOR:19118207 |
| TLN1 | Q9Y490 | ITB8 | P26012 | Yes | Yes | No | WangSIGNOR | SIGNOR:19118207 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
769
Mass
85,632
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P26012-1; Sequence=Displayed; Name=2; IsoId=P26012-2; Sequence=VSP_056531
Alternative Sequence
1..135; Missing (in isoform 2)
3D Structural Models
Turn
197..199; 210..215; 315..319
Helix
157..159; 160..165; 166..168; 170..180; 204..208; 235..242; 256..265; 267..270; 292..297; 325..335; 348..353; 355..357; 373..384
Beta Strand
105..107; 117..124; 135..139; 147..154; 182..191; 223..232; 250..254; 274..283; 309..314; 337..343; 361..365; 390..393; 396..398; 400..406; 408..410; 412..414; 415..417; 419..421; 424..426; 428..435; 448..452; 459..462
3D Structure
Electron microscopy (9); X-ray crystallography (2)
Domain & Motif Annotations
Domain (CC)
The VWFA domain (or beta I domain) contains two cation-binding sites: the ligand-associated metal ion-binding site (LIMBS or SyMBS) and the metal ion-dependent adhesion site (MIDAS) (PubMed:31792290). Unlike in the other beta integrins, the cation-binding site adjacent MIDAS site (ADMIDAS) in ITGB8 is not functional due to the presence of two Asn residues instead of 2 Asp residues (PubMed:31792290). This domain is also part of the ligand-binding site (PubMed:31792290).
Domain (FT)
46..95; PSI; 146..384; VWFA; 471..495; I-EGF 1; 499..547; I-EGF 2; 548..584; I-EGF 3; 585..625; I-EGF 4
Protein Families
Integrin beta chain family
Sequence Similarities
Belongs to the integrin beta chain family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Related Diseases
Biomarker
Phase 1
Drugs