Protein detail
CTNA2
Catenin alpha-2 (Alpha N-catenin) (Alpha-catenin-related protein)
Entry name CTNA2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Catenin alpha-2 (Alpha N-catenin) (Alpha-catenin-related protein)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CAP-RCT114
Gene Description
Catenin alpha 2
Chromosome
2
Position
79185231-80648861
EVMP confidence score
0.38
Fluorescence & Localization3
Tissue Specificskin 1Cell SpecificEpicardial cellsSingle-Nuclei Brain Specificlower rhombic lip
Function & Pathway7
Protein Function (3)
- Disease related genes
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Predicted intracellular proteins
Cellular Component (7)
Molecular Function (5)
Biological Process (3)
KEGG (9)
- hsa04390 Hippo signaling pathway
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04670 Leukocyte transendothelial migration
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05213 Endometrial cancer
- KEGG:hsa05226 Gastric cancer
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
Reactome
Mediation Categories
Fusion and delivery mediation
Relations & Evidence12
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | No | No | No |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CTNA2 | P26232 | YAP1 | P46937 | Yes | No | Yes | SIGNOR | SIGNOR:23431053 |
Sequence, Structure & Domains12
Sequences
Length
953
Mass
105,313
Sequence
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=AlphaN-catenin II; IsoId=P26232-1; Sequence=Displayed; Name=2; Synonyms=AlphaN-catenin I; IsoId=P26232-2; Sequence=VSP_020337; Name=3; IsoId=P26232-3; Sequence=VSP_038009; Name=4; IsoId=P26232-4; Sequence=VSP_038008, VSP_020337; Name=5; IsoId=P26232-5; Sequence=VSP_038007, VSP_020337; Name=6; Synonyms=AlphaN-catenin III; IsoId=P26232-6; Sequence=VSP_038005, VSP_038006, VSP_020337
Alternative Sequence
1..368; Missing (in isoform 4); 1..351; Missing (in isoform 6); 1; M -> MSGLICLQYGLWHGQKIDFGGPRRLLQRNRGEGSM (in isoform 5); 352; N -> MDGWRRPLQSVGKVCEKNMKTSEMHTMSGAQ (in isoform 6); 766..858; Missing (in isoform 3); 811..858; Missing (in isoform 2, isoform 4, isoform 5 and isoform 6)
3D Structural Models
Helix
677..702; 710..729; 738..765; 769..792; 861..894
Beta Strand
798..802; 805..809
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
912..927; Basic and acidic residues; 928..938; Basic residues
Region
912..939; Disordered
Protein Families
Vinculin/alpha-catenin family
Sequence Similarities
Belongs to the vinculin/alpha-catenin family.
Clinical Relevance6
Disease Involvement (2)
Disease variantLissencephaly
Drugs (15)
Antibody
Interaction Protein
ENSG00000168036
Interaction Count
1
Interaction Dataset
intact_biogrid