Protein detail
CD82
CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)
Entry name CD82 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 14 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Transmembrane
12..32; Helical; 54..72; Helical; 84..110; Helical; 229..250; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
IA4KAI1R2ST6TSPAN27
Gene Description
CD82 molecule
Chromosome
11
Position
44564427-44620358
Supporting publications (n)
14
EVMP confidence score
0.47
Fluorescence & Localization1
Function & Pathway6
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function
Biological Process (3)
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence26
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| R SequencingMass spectrometry | 0 |
Sequence, Structure & Domains7
Sequences
Length
267
Mass
29,626
Sequence
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P27701-1; Sequence=Displayed; Name=2; IsoId=P27701-2; Sequence=VSP_045656
Alternative Sequence
88..112; Missing (in isoform 2)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance4
Disease Involvement
Cancer-related genes
Drug Targets
Literature-reported target
Drugs
Supporting Publications14
| PMID | Title | Abstract |
|---|---|---|
| 14633944 | Intestinal epithelial exosomes carry MHC class II/peptides able to inform the immune system in mice. | A33 antigen, an Ig-like molecule highly specific for intestinal epithelial cells, was enriched in exosomes and was also found in mice mesenteric lymph nodes, suggesting exosome migration towards the gut associated lymphoid tissues. CONCLUSIONS: Epithelial exosomes are antigen presenting vesicles bearing MHC class II/peptide complexes that prime for an immunogenic rather than tolerogenic response in the context of a systemic challenge. In contrast, exosomes obtained after incubation with IFN-gamma (EXO-hOVA-IFN), bearing abundant MHC class II/OVA complexes, induced a specific humoral immune response. RESULTS: MODE K epithelial exosomes displayed major histocompatibility complex (MHC) class I and class II (upregulated by IFN-gamma) molecules and tetraspan proteins (CD9, CD81, CD82) potentially involved in the binding to target cells. |
| 17484880 | T84-intestinal epithelial exosomes bear MHC class II/peptide complexes potentiating antigen presentation by dendritic cells. | RESULTS: T84-derived exosomes, enriched in CD9, CD81, CD82, and A33 antigen, were capable of binding specifically human serum albumin (HSA) 64-76 peptide on HLA-DR4 molecules and of interacting preferentially with DCs. |
| 23289620 | Tetraspanin protein CD9 interacts with metalloprotease CD10 and enhances its release via exosomes. | The peptidase activity of CD10 measured either on cells or on exosomes correlated with the level of CD10 expression, and was not significantly modulated by CD9 expression as such. The stable expression of wild-type CD9 in K562 CD10-positive cells enhanced the level of CD10 released with exosomes five-fold. |
| 25912735 | EGFR over-expression in non-small cell lung cancers harboring EGFR mutations is associated with marked down-regulation of CD82. | Active exportation of CD82 through the exosome was one of the mechanisms involved in achieving the overall CD82 down-regulation in mutant EGFR-expressing lung cancer cell lines. |
| 29723143 | [The role of exosomal tetraspanins and proteases in tumor progression]. | Major (CD9, CD63, CD81) and others (CD82, CD151, Tspan8) tetraspanins are widely represented in exosomes, where they interact with various proteins and form functional tetraspanin complexes. |
| 30604894 | Exosomal protein CD82 as a diagnostic biomarker for precision medicine for breast cancer. | CD82, a member of the tetraspanin superfamily, has been proposed to exert its activity via tetra-transmembrane protein enriched microdomains (TEMs) in exosomes. The present study aimed to explore the potential of the exosome protein CD82 in diagnosing breast cancers of all stages and various histological subtypes in patients. There was a significant negative correlation between CD82 expression in tissues and CD82 content in exosomes, which indicated that CD82 expression was redistributed from tissues to the blood with the development and metastasis of breast cancer. |
| 31034520 | Comprehensive analysis of miRNA and protein profiles within exosomes derived from canine lymphoid tumour cell lines. | In the comparison of the amounts of miRNAs and proteins among the cell lines, those of three miRNAs (miR-151, miR-8908a-3p, and miR-486) and CD82 protein differed between exosomes derived from vincristine-sensitive and resistant cell lines. |
| 31807237 | Tetraspanin CD82 interaction with cholesterol promotes extracellular vesicle-mediated release of ezrin to inhibit tumour cell movement. | Importantly, CD82-cholesterol/-lipid raft interaction not only promotes extracellular release of lipid raft components such as cholesterol and gangliosides but also facilitates extracellular vesicle (EV)-mediated release of ezrin-radixin-moesin (ERM) protein Ezrin. |
| 34473505 | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. | No abstract available |
| 34684727 | Proteomic Signature of Extracellular Vesicles for Lung Cancer Recognition. | By applying targeted mass spectrometry with stable isotope-labeled peptide standards, we assessed the levels of 28 EV-associated proteins, including the conventional exosome markers CD9, CD63, CD81, CD82, and HSPA8, in vesicles derived from the lung cancer cell lines NCI-H23 and A549. |
Page 1 of 2Next