Protein detail

CD82

CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)

Entry name CD82	UniProt ID P27701	EVMP confidence score 0.47
Supporting publications (n) 14	Transmembrane count 4	Protein classification Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)

Protein Class (5)

Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Predicted intracellular proteins

Transmembrane

12..32; Helical; 54..72; Helical; 84..110; Helical; 229..250; Helical

Transmembrane Count

Ensembl

ENSG00000085117

Entrez Gene Symbol

CD82

Gene Synonym (5)

IA4KAI1R2ST6TSPAN27

Gene Description

CD82 molecule

Chromosome

Position

44564427-44620358

Supporting publications (n)

EVMP confidence score

0.47

Fluorescence & Localization1

Function & Pathway6

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Predicted intracellular proteins

Cellular Component (3)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG

hsa04115 p53 signaling pathway

Mediation Categories (2)

Clinical-translation mediationFusion and delivery mediation

Relations & Evidence26

Ligand-Receptor Signaling (25)

25 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	LOCATE	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	Cellinker	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	No	Yes	No

Page 2 of 3Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	R SequencingMass spectrometry	0

Sequence, Structure & Domains7

Sequences

Length

267

Mass

29,626

Sequence

MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P27701-1; Sequence=Displayed; Name=2; IsoId=P27701-2; Sequence=VSP_045656

Alternative Sequence

88..112; Missing (in isoform 2)

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance4

Disease Involvement

Cancer-related genes

Drug Targets

Literature-reported target

Drugs

NERVE GROWTH FACTOR

Antibody (3)

CAB002508 HPA028900 HPA061418

Supporting Publications14

PMID	Title	Abstract
14633944	Intestinal epithelial exosomes carry MHC class II/peptides able to inform the immune system in mice.	A33 antigen, an Ig-like molecule highly specific for intestinal epithelial cells, was enriched in exosomes and was also found in mice mesenteric lymph nodes, suggesting exosome migration towards the gut associated lymphoid tissues. CONCLUSIONS: Epithelial exosomes are antigen presenting vesicles bearing MHC class II/peptide complexes that prime for an immunogenic rather than tolerogenic response in the context of a systemic challenge. In contrast, exosomes obtained after incubation with IFN-gamma (EXO-hOVA-IFN), bearing abundant MHC class II/OVA complexes, induced a specific humoral immune response. RESULTS: MODE K epithelial exosomes displayed major histocompatibility complex (MHC) class I and class II (upregulated by IFN-gamma) molecules and tetraspan proteins (CD9, CD81, CD82) potentially involved in the binding to target cells.
17484880	T84-intestinal epithelial exosomes bear MHC class II/peptide complexes potentiating antigen presentation by dendritic cells.	RESULTS: T84-derived exosomes, enriched in CD9, CD81, CD82, and A33 antigen, were capable of binding specifically human serum albumin (HSA) 64-76 peptide on HLA-DR4 molecules and of interacting preferentially with DCs.
23289620	Tetraspanin protein CD9 interacts with metalloprotease CD10 and enhances its release via exosomes.	The peptidase activity of CD10 measured either on cells or on exosomes correlated with the level of CD10 expression, and was not significantly modulated by CD9 expression as such. The stable expression of wild-type CD9 in K562 CD10-positive cells enhanced the level of CD10 released with exosomes five-fold.
25912735	EGFR over-expression in non-small cell lung cancers harboring EGFR mutations is associated with marked down-regulation of CD82.	Active exportation of CD82 through the exosome was one of the mechanisms involved in achieving the overall CD82 down-regulation in mutant EGFR-expressing lung cancer cell lines.
29723143	[The role of exosomal tetraspanins and proteases in tumor progression].	Major (CD9, CD63, CD81) and others (CD82, CD151, Tspan8) tetraspanins are widely represented in exosomes, where they interact with various proteins and form functional tetraspanin complexes.
30604894	Exosomal protein CD82 as a diagnostic biomarker for precision medicine for breast cancer.	CD82, a member of the tetraspanin superfamily, has been proposed to exert its activity via tetra-transmembrane protein enriched microdomains (TEMs) in exosomes. The present study aimed to explore the potential of the exosome protein CD82 in diagnosing breast cancers of all stages and various histological subtypes in patients. There was a significant negative correlation between CD82 expression in tissues and CD82 content in exosomes, which indicated that CD82 expression was redistributed from tissues to the blood with the development and metastasis of breast cancer.
31034520	Comprehensive analysis of miRNA and protein profiles within exosomes derived from canine lymphoid tumour cell lines.	In the comparison of the amounts of miRNAs and proteins among the cell lines, those of three miRNAs (miR-151, miR-8908a-3p, and miR-486) and CD82 protein differed between exosomes derived from vincristine-sensitive and resistant cell lines.
31807237	Tetraspanin CD82 interaction with cholesterol promotes extracellular vesicle-mediated release of ezrin to inhibit tumour cell movement.	Importantly, CD82-cholesterol/-lipid raft interaction not only promotes extracellular release of lipid raft components such as cholesterol and gangliosides but also facilitates extracellular vesicle (EV)-mediated release of ezrin-radixin-moesin (ERM) protein Ezrin.
34473505	Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.	No abstract available
34684727	Proteomic Signature of Extracellular Vesicles for Lung Cancer Recognition.	By applying targeted mass spectrometry with stable isotope-labeled peptide standards, we assessed the levels of 28 EV-associated proteins, including the conventional exosome markers CD9, CD63, CD81, CD82, and HSPA8, in vesicles derived from the lung cancer cell lines NCI-H23 and A549.

Page 1 of 2Next