Protein detail
CD82
CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)
Entry name CD82 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 14 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Transmembrane
12..32; Helical; 54..72; Helical; 84..110; Helical; 229..250; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
IA4KAI1R2ST6TSPAN27
Gene Description
CD82 molecule
Chromosome
11
Position
44564427-44620358
Supporting publications (n)
14
EVMP confidence score
0.47
Fluorescence & Localization1
Function & Pathway6
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function
Biological Process (3)
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence26
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 3 of 3Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| R SequencingMass spectrometry | 0 |
Sequence, Structure & Domains7
Sequences
Length
267
Mass
29,626
Sequence
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P27701-1; Sequence=Displayed; Name=2; IsoId=P27701-2; Sequence=VSP_045656
Alternative Sequence
88..112; Missing (in isoform 2)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance4
Disease Involvement
Cancer-related genes
Drug Targets
Literature-reported target
Drugs
Supporting Publications14
| PMID | Title | Abstract |
|---|---|---|
| 35728771 | Proteomic profiling of plasma exosomes reveals CD82 involvement in the development of esophageal squamous cell carcinoma. | CD82 in exosomes is involved in the development of ESCC. The proteomic results showed that the quantity of CD82 in exosomes of EIN was significantly higher than that in patients with BED and ESCC. |
| 36189227 | Isolation of a cytolytic subpopulation of extracellular vesicles derived from NK cells containing NKG7 and cytolytic proteins. | No abstract available |
| 38335265 | "Triple-Punch" Strategy Exosome-Mimetic Nanovesicles for Triple Negative Breast Cancer Therapy. | CD82 is a tumor metastasis inhibitory molecule that is enriched in exosomes. |
| 9685355 | Selective enrichment of tetraspan proteins on the internal vesicles of multivesicular endosomes and on exosomes secreted by human B-lymphocytes. | In this study, we show that exosomes are enriched in the co-stimulatory molecule CD86 and in several tetraspan proteins, including CD37, CD53, CD63, CD81, and CD82. |
Page 2 of 2Previous