Protein detail
AA2AR
Adenosine receptor A2a
Entry name AA2AR | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 3 | Transmembrane count 7 | Protein classification Cancer-related genesFDA approved drug targetsG-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Adenosine receptor A2a
Protein Class (6)
Cancer-related genesFDA approved drug targetsG-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (6)
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
- FDA approved drug targets:Small molecule drugs
Transmembrane
8..32; Helical; Name=1; 43..66; Helical; Name=2; 78..100; Helical; Name=3; 121..143; Helical; Name=4; 174..198; Helical; Name=5; 235..258; Helical; Name=6; 267..290; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ADORA2RDC8
Gene Description
Adenosine A2a receptor
Chromosome
22
Position
24417879-24442357
Supporting publications (n)
3
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificstomach 1Cell SpecificFoveolar cellsSingle-Nuclei Brain Specificdeep-layer near-projecting
Function & Pathway
Protein Function (6)
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
- FDA approved drug targets:Small molecule drugs
Cellular Component (11)
- GO:0005882 intermediate filament
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0030425 dendrite
- GO:0030673 axolemma
- GO:0032279 asymmetric synapse
- GO:0042734 presynaptic membrane
- GO:0043025 neuronal cell body
- GO:0045211 postsynaptic membrane
- GO:0048786 presynaptic active zone
Page 1 of 2
Molecular Function (9)
- GO:0001609 G protein-coupled adenosine receptor activity
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0008289 lipid binding
- GO:0019899 enzyme binding
- GO:0031802 type 5 metabotropic glutamate receptor binding
- GO:0042802 identical protein binding
- GO:0044877 protein-containing complex binding
- GO:0051393 alpha-actinin binding
Biological Process (3)
KEGG (8)
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04080 Neuroactive ligand-receptor interaction
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa05012 Parkinson disease
- KEGG:hsa05034 Alcoholism
Reactome (10)
- R-hsa-187015 activation of trka receptors
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-418555 g alpha s signalling events
- R-hsa-187024 ngf independant trka activation
- R-hsa-418038 nucleotide like purinergic receptors
- R-hsa-372790 signaling by gpcr
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-5683826 surfactant metabolism
Canonical Pathways (3)
- M234 Pid il2 stat5 pathway
- M143 Pid il2 pi3k pathway
- M122 Pid il2 1pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence64
Ligand-Receptor Signaling (50)
50 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| seven_transmembrane_7tm | receptor | HPMR | Yes | Yes | |||
| 7tm_a | receptor | HPMR | Yes | Yes | |||
| adenosine_7tm_a | receptor | HPMR | Yes | Yes | |||
| rhodopsin | receptor | Surfaceome | Yes | Yes | |||
| gpcr | receptor | Surfaceome | Yes | Yes | |||
| class_a_rhodopsin | receptor | GPCRdb | Yes | Yes | |||
| class_a_rhodopsin_nucleotide | receptor | GPCRdb | Yes | Yes | |||
| class_a_rhodopsin_nucleotide_adenosine | receptor | GPCRdb | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | HPMR | Yes |
Regulatory Interaction Network (11)
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AA2AR | P29274 | GNAI3 | P08754 | Yes | Yes | SIGNOR | SIGNOR:31160049 |
Page 2 of 2Previous
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
412
Mass
44,707
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
3D Structural Models
Turn
304..307; 308..310
Helix
2..33; 35..37; 40..57; 59..67; 74..107; 109..115; 118..136; 138..141; 151..157; 168..171; 174..179; 182..185; 187..208; 219..258; 267..291; 293..303; 312..317
Beta Strand
71..73; 144..146; 158..160; 163..165; 213..216; 260..262
3D Structure
Electron microscopy (6); X-ray crystallography (86)
Domain & Motif Annotations
Domain (CC)
The cytoplasmic C-terminal domain is necessary for targeting the non-ubiquitinated form of this protein to the cell surface.
Region
391..412; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Disease Involvement (2)
Cancer-related genesFDA approved drug targets
Related Diseases (23)
Alzheimer diseaseArterial occlusive diseaseChoreiform disorderChronic obstructive pulmonary diseaseColorectal cancerCoronary atherosclerosisDiabetic foot ulcerGeneral pain disorderGlaucomaHeart failureHyper-lipoproteinaemiaHypertensionLung cancerMultiple sclerosisOrthostatic hypotensionPainParkinsonismProstate cancerRadionuclide imagingSchizophreniaSolid tumour/cancerUnspecific substance use disorderVasomotor/allergic rhinitis
Biomarker
Discontinued in Phase 3; Phase 1/2; Phase 1; Phase 2; Phase 3; Discontinued in Phase 1; Terminated; Approved; Discontinued in Phase 2
Drug Targets
FDA approved drug targets
Drugs (37)
SCH442416EVODENOSONREGADENOSON ANHYDROUSNULLISTRADEFYLLINECHEMBL:CHEMBL27508THEOPHYLLINE SODIUM GLYCINATEBVT.115959PBF-509ST-1535OXTRIPHYLLINEBINODENOSONIMARADENANTCIFORADENANTAMINOPHYLLINEPRELADENANTTHEOPHYLLINECAFFEINE CITRATECAFFEINEADENOSINEAPADENOSONSONEDENOSONUK-432097CGS 21680TOZADENANTVIPADENANTTHERAPEUTIC CORTICOSTEROIDGW-328267UK-432,097DEXEFAROXANETRUMADENANTAMP579PENTOXIFYLLINEPBF-999TONAPOFYLLINELEVODOPACHEMBL:CHEMBL1950650
Interaction Protein (3)
ENSG00000103154ENSG00000105443ENSG00000170775
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications3
| PMID | Title | Related sentences |
|---|---|---|
| 27821849 | Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation. | No related sentences available |
| 35119778 | Optimization of small extracellular vesicle isolation from expressed prostatic secretions in urine for in-depth proteomic analysis. | No related sentences available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No related sentences available |