Protein detail
AA2AR
Adenosine receptor A2a
Protein symbol AA2AR | UniProt ID | EVMP score 0.50 |
Frequency 3 | Transmembrane count 7 | Protein classification Cancer-related genesFDA approved drug targetsG-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Adenosine receptor A2a
Protein Class
Cancer-related genesFDA approved drug targetsG-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
- FDA approved drug targets:Small molecule drugs
Transmembrane
8..32; Helical; Name=1; 43..66; Helical; Name=2; 78..100; Helical; Name=3; 121..143; Helical; Name=4; 174..198; Helical; Name=5; 235..258; Helical; Name=6; 267..290; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
ADORA2RDC8
Gene Description
Adenosine A2a receptor
Chromosome
22
Position
24417879-24442357
Frequency
3
EVMP Score
0.50
Fluorescence & Localization
Tissue Specificstomach 1Cell SpecificFoveolar cellsSingle-Nuclei Brain Specificdeep-layer near-projecting
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
- FDA approved drug targets:Small molecule drugs
Cellular Component
- GO:0005882 intermediate filament
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0030425 dendrite
- GO:0030673 axolemma
- GO:0032279 asymmetric synapse
- GO:0042734 presynaptic membrane
- GO:0043025 neuronal cell body
- GO:0045211 postsynaptic membrane
- GO:0048786 presynaptic active zone
- GO:0098978 glutamatergic synapse
Molecular Function
- GO:0001609 G protein-coupled adenosine receptor activity
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0008289 lipid binding
- GO:0019899 enzyme binding
- GO:0031802 type 5 metabotropic glutamate receptor binding
- GO:0042802 identical protein binding
- GO:0044877 protein-containing complex binding
- GO:0051393 alpha-actinin binding
Biological Process
KEGG
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04080 Neuroactive ligand-receptor interaction
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa05012 Parkinson disease
- KEGG:hsa05034 Alcoholism
Reactome
- R-hsa-187015 activation of trka receptors
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-418555 g alpha s signalling events
- R-hsa-187024 ngf independant trka activation
- R-hsa-418038 nucleotide like purinergic receptors
- R-hsa-372790 signaling by gpcr
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-5683826 surfactant metabolism
Canonical Pathways
- M234 Pid il2 stat5 pathway
- M143 Pid il2 pi3k pathway
- M122 Pid il2 1pathway
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
50 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
Regulatory Interaction Network
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AA2AR | P29274 | GNAS3 | O95467 | Yes | Yes | No | WangHINTSIGNORCA1 | CA1:6162091SIGNOR:31160049HINT:29726815HINT:27462812CA1:8995267 |
| AA2AR | P29274 | ALEX | P84996 | Yes | Yes | No | WangHINTSIGNORCA1 | CA1:6162091SIGNOR:31160049HINT:29726815HINT:27462812CA1:8995267 |
| AA2AR | P29274 | GNAS2 | P63092 | Yes | Yes | No | WangHINTSIGNORCA1 | CA1:6162091SIGNOR:31160049HINT:29726815HINT:27462812CA1:8995267 |
| AA2AR | P29274 | GNAS1 | Q5JWF2 | Yes | Yes | No | WangHINTSIGNORCA1 | CA1:6162091SIGNOR:31160049HINT:29726815HINT:27462812CA1:8995267 |
| AA2AR | P29274 | GNAQ | P50148 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| AA2AR | P29274 | GNA14 | O95837 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| AA2AR | P29274 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| AA2AR | P29274 | GNAL | P38405 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| AA2AR | P29274 | GNAI1 | P63096 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| AA2AR | P29274 | GNAZ | P19086 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Page 1 of 2Next
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
412
Mass
44,707
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
3D Structural Models
Turn
304..307; 308..310
Helix
2..33; 35..37; 40..57; 59..67; 74..107; 109..115; 118..136; 138..141; 151..157; 168..171; 174..179; 182..185; 187..208; 219..258; 267..291; 293..303; 312..317
Beta Strand
71..73; 144..146; 158..160; 163..165; 213..216; 260..262
3D Structure
Electron microscopy (6); X-ray crystallography (86)
Domain & Motif Annotations
Domain (CC)
The cytoplasmic C-terminal domain is necessary for targeting the non-ubiquitinated form of this protein to the cell surface.
Region
391..412; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Disease Involvement
Cancer-related genesFDA approved drug targets
Related Diseases
Alzheimer diseaseArterial occlusive diseaseChoreiform disorderChronic obstructive pulmonary diseaseColorectal cancerCoronary atherosclerosisDiabetic foot ulcerGeneral pain disorderGlaucomaHeart failureHyper-lipoproteinaemiaHypertensionLung cancerMultiple sclerosisOrthostatic hypotensionPainParkinsonismProstate cancerRadionuclide imagingSchizophreniaSolid tumour/cancerUnspecific substance use disorderVasomotor/allergic rhinitis
Biomarker
Discontinued in Phase 3; Phase 1/2; Phase 1; Phase 2; Phase 3; Discontinued in Phase 1; Terminated; Approved; Discontinued in Phase 2
Drug Targets
FDA approved drug targets
Drugs
SCH442416EVODENOSONREGADENOSON ANHYDROUSNULLISTRADEFYLLINECHEMBL:CHEMBL27508THEOPHYLLINE SODIUM GLYCINATEBVT.115959PBF-509ST-1535OXTRIPHYLLINEBINODENOSONIMARADENANTCIFORADENANTAMINOPHYLLINEPRELADENANTTHEOPHYLLINECAFFEINE CITRATECAFFEINEADENOSINEAPADENOSONSONEDENOSONUK-432097CGS 21680TOZADENANTVIPADENANTTHERAPEUTIC CORTICOSTEROIDGW-328267UK-432,097DEXEFAROXANETRUMADENANTAMP579PENTOXIFYLLINEPBF-999TONAPOFYLLINELEVODOPACHEMBL:CHEMBL1950650
Interaction Protein
ENSG00000103154ENSG00000105443ENSG00000170775
Interaction Count
3
Interaction Dataset
intact_biogrid