Protein detail
AA2BR
Adenosine receptor A2b
Entry name AA2BR | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count 7 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Adenosine receptor A2b
Protein Function (3)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
9..33; Helical; Name=1; 44..67; Helical; Name=2; 79..101; Helical; Name=3; 122..144; Helical; Name=4; 179..203; Helical; Name=5; 236..259; Helical; Name=6; 268..291; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificintestineCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function (3)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
KEGG (6)
Reactome (10)
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-418555 g alpha s signalling events
- R-hsa-5663205 infectious disease
- R-hsa-9658195 leishmania infection
- R-hsa-418038 nucleotide like purinergic receptors
- R-hsa-372790 signaling by gpcr
- R-hsa-5683826 surfactant metabolism
Canonical Pathways (3)
- M234 Pid il2 stat5 pathway
- M143 Pid il2 pi3k pathway
- M122 Pid il2 1pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence71
Ligand-Receptor Signaling (58)
58 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | iTALK | Yes | Yes | |||
| receptor | receptor | Almen2009 | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| receptor | receptor | EMBRACE | Yes | Yes | |||
| gpcr | receptor | GPCRdb | Yes | Yes | |||
| adenosine | receptor | HGNC | Yes | Yes | |||
| receptor | receptor | HGNC | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 6 of 6Previous
Regulatory Interaction Network (11)
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AA2BR | P29275 | GNAS3 | O95467 | Yes | Yes | WangHINTSIGNOR | HINT:36563137HINT:36575181SIGNOR:31160049 | |
| AA2BR | P29275 | ALEX | P84996 | Yes | Yes | WangHINTSIGNOR | HINT:36563137HINT:36575181SIGNOR:31160049 | |
| AA2BR | P29275 | GNAS2 | P63092 | Yes | Yes | WangHINTSIGNOR | HINT:36563137HINT:36575181SIGNOR:31160049 | |
| AA2BR | P29275 | GNAS1 | Q5JWF2 | Yes | Yes | WangHINTSIGNOR | HINT:36563137HINT:36575181SIGNOR:31160049 | |
| AA2BR | P29275 | GNAO | P09471 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| AA2BR | P29275 | GNAI1 | P63096 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| AA2BR | P29275 | GNAQ | P50148 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| AA2BR | P29275 | GNAZ | P19086 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| AA2BR | P29275 | GNA14 | O95837 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| AA2BR | P29275 | GNAI3 | P08754 | Yes | Yes | SIGNOR | SIGNOR:31160049 |
Page 1 of 2Next
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
332
Mass
36,333
Sequence
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL
3D Structural Models
Turn
147..149; 184..186; 268..270; 290..293
Helix
5..34; 41..58; 60..68; 75..108; 110..116; 119..137; 139..142; 173..176; 179..183; 187..190; 192..214; 225..258; 262..265; 271..289; 295..308
3D Structure
Electron microscopy (4)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (14)
Biomarker
Discontinued in Phase 3; Phase 1; Phase 1/2; Phase 2; Approved; Preclinical; Terminated; IND submitted; Investigative
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |