EV MemProt Atlas

Basic Information6

Protein Names

Collagen alpha-5(IV) chain

Protein Function (6)

Predicted intracellular proteins
Cancer-related genes:Candidate cancer biomarkers
Predicted secreted proteins
Human disease related genes:Congenital malformations:Other congenital malformations
Disease related genes
Human disease related genes:Reproductive system diseases:Reproductive system diseases

Ensembl

ENSG00000188153

Entrez Gene Symbol

COL4A5

Supporting publications (n)

1

EVMP confidence score

0.50

Function & Pathway7

Protein Function (6)

Predicted intracellular proteins
Cancer-related genes:Candidate cancer biomarkers
Predicted secreted proteins
Human disease related genes:Congenital malformations:Other congenital malformations
Disease related genes
Human disease related genes:Reproductive system diseases:Reproductive system diseases

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

KEGG (13)

Page 1 of 2

Reactome (25)

Page 1 of 3

Mediation Categories (2)

Clinical-translation mediationReceptor-signaling mediation

Relations & Evidence36

Ligand-Receptor Signaling (20)

20 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No
secreted	secreted	HPA_secretome	No	No	Yes	No	No
secreted	secreted	connectomeDB2020	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
ecm	ecm	CellChatDB	Yes	No	Yes	No	No
ecm	ecm	Cellinker	Yes	No	Yes	No	No
collagen	ecm	Matrisome	Yes	No	Yes	No	No
basement_membrane	ecm	Matrisome	Yes	No	Yes	No	No

Page 2 of 2Previous

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CO4A5	P29400		COMPLEX:P05556_P56199	Yes	Yes	No	CellPhoneDBICELLNETSIGNOR	ICELLNET:15147720 ICELLNET:21421911 ICELLNET:16988024 SIGNOR:35267698 ICELLNET:26857815

Protein Complex Composition (14)

14 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Collagen type IV trimer variant 2	COL4A5 COL4A6	P29400 Q14031	1:1	ComplexPortal	intact:EBI-2461418	17876790 14755292 1916105
Collagen type IV trimer variant 3	COL4A3 COL4A4 COL4A5	P29400 P53420 Q01955	1:1:1	ComplexPortal	intact:EBI-2461456	17876790 14755292 1916105
HT_DM_Cluster278	COL1A1 COL22A1 COL24A1 COL4A1 COL4A2 COL4A3 COL4A4 COL4A5 COL4A6 COL7A1	P02452 P02462 P08572 P29400 P53420 Q01955 Q02388 Q14031 Q17RW2 Q8NFW1	1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2276	22036573
	COL13A1 COL25A1 COL4A1 COL4A2 COL4A5 COL4A6 FOXA1 MEX3D ODF2 PLK4 PLOD1	O00444 P02462 P08572 P29400 P55317 Q02809 Q14031 Q5BJF6 Q5TAT6 Q86XN8 Q9BXS0	0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
	COL4A3 COL4A4 COL4A5 COL4A6 PRMT3 SERPINE2 TXN	O60678 P07093 P10599 P29400 P53420 Q01955 Q14031	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9535
	COL2A1 COL4A5 COL5A1 COL8A2	P02458 P20908 P25067 P29400	0:0:0:0	hu.MAPhu.MAP2
	COL2A1 COL4A5 COL8A2	P02458 P25067 P29400	0:0:0	hu.MAPhu.MAP2
	COL4A1 COL4A2 COL4A3 COL4A4 COL4A5 COL4A6 EEF1AKMT2 SERPINE2	P02462 P07093 P08572 P29400 P53420 Q01955 Q14031 Q5JPI9	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7794
	COL4A1 COL4A2 COL4A5 COL4A6 PLOD1	P02462 P08572 P29400 Q02809 Q14031	0:0:0:0:0	hu.MAP2
	COL4A3 COL4A4 COL4A5 COL4A6 NR1H2 SERPINE2 VDAC3	P07093 P29400 P53420 P55055 Q01955 Q14031 Q9Y277	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8249

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	7	38871114 38037300 34265469 39535266 38576002 40689422 39996590

Sequence, Structure & Domains15

Sequences

Length

1,685

Mass

161,044

Sequence

MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPGLPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKGERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKGDRGFPGPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGLPGPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQVCMKRT

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P29400-1; Sequence=Displayed; Name=2; IsoId=P29400-2; Sequence=VSP_001173

Alternative Sequence

1264; G -> GPTGFQG (in isoform 2)

3D Structural Models

Turn

1523..1525

Helix

1506..1508; 1554..1560; 1605..1607; 1617..1619; 1654..1656; 1668..1670; 1672..1674

Beta Strand

1461..1467; 1469..1472; 1481..1494; 1497..1500; 1509..1512; 1518..1521; 1527..1530; 1535..1540; 1563..1571; 1573..1577; 1579..1582; 1590..1603; 1609..1611; 1620..1623; 1629..1633; 1636..1639; 1645..1650; 1657..1659; 1664..1666; 1677..1683

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

52..61; Low complexity; 62..73; Pro residues; 188..212; Pro residues; 214..225; Low complexity; 246..257; Basic and acidic residues; 266..281; Pro residues; 284..305; Basic and acidic residues; 324..333; Basic and acidic residues; 413..430; Low complexity; 431..445; Pro residues; 493..505; Pro residues; 620..630; Pro residues; 709..727; Pro residues; 788..797; Low complexity; 848..859; Pro residues; 868..880; Pro residues; 882..901; Low complexity; 912..931; Low complexity; 983..999; Low complexity; 1010..1026; Low complexity; 1111..1120; Low complexity; 1139..1148; Pro residues; 1149..1158; Gly residues; 1202..1211; Gly residues; 1234..1243; Pro residues; 1256..1274; Pro residues; 1295..1308; Low complexity; 1353..1362; Pro residues

Domain (CC)

Alpha chains of type IV collagen have a non-collagenous domain (NC1) at their C-terminus, frequent interruptions of the G-X-Y repeats in the long central triple-helical domain (which may cause flexibility in the triple helix), and a short N-terminal triple-helical 7S domain.

Domain (FT)

1461..1685; Collagen IV NC1

Region

27..41; Nonhelical region (NC2); 42..1456; Triple-helical region; 49..1459; Disordered

Protein Families

Type IV collagen family

Sequence Similarities

Belongs to the type IV collagen family.

Clinical Relevance1

Drugs (2)

OCRIPLASMIN COLLAGENASE CLOSTRIDIUM HISTOLYTICUM-AAES

Supporting Publications1

PMID	Title	Abstract
41167904	Accessing the proteome of extracellular vesicles via rapid acoustic isolation of a minute human blood plasma sample.	No abstract available

Entry name CO4A5	UniProt ID P29400	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification