Protein detail
MARCS
Myristoylated alanine-rich C-kinase substrate (MARCKS) (Protein kinase C substrate, 80 kDa protein, light chain) (80K-L protein) (PKCSL)
Entry name MARCS | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 10 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Myristoylated alanine-rich C-kinase substrate (MARCKS) (Protein kinase C substrate, 80 kDa protein, light chain) (80K-L protein) (PKCSL)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
80K-LMACSPKCSL
Gene Description
Myristoylated alanine rich protein kinase C substrate
Chromosome
6
Position
113857345-113863475
Supporting publications (n)
10
EVMP confidence score
0.63
Fluorescence & Localization1
Cell SpecificEarly spermatids
Function & Pathway8
Protein Function
Predicted intracellular proteins
Cellular Component (9)
Molecular Function (4)
Biological Process (3)
Reactome (3)
Canonical Pathways
M182 Pid il3 pathway
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence77
Enzyme-Mediated Modification (61)
61 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| MARCKS | CDK1 | P06493 | S | 26 | phosphorylation | KEA | KEA:17570479 |
Page 7 of 7Previous
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| actin_regulation_adhesome | intracellular_intercellular_related | Adhesome | Yes | No | No | No | No |
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (5)
5 records.
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blotting | 1 | 37922300 |
Sequence, Structure & Domains7
Sequences
Length
332
Mass
31,555
Sequence
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE
Domain & Motif Annotations
Compositional Bias
26..35; Polar residues; 73..102; Low complexity; 110..136; Low complexity; 152..164; Basic residues; 197..227; Low complexity; 250..271; Basic and acidic residues; 272..332; Low complexity
Region
1..332; Disordered; 152..176; Calmodulin-binding (PSD)
Protein Families
MARCKS family
Sequence Similarities
Belongs to the MARCKS family.
Clinical Relevance4
Related Diseases (2)
Biomarker
Phase 2
Drugs
Supporting Publications10
| PMID | Title | Abstract |
|---|---|---|
| 25776846 | Human thymic epithelial primary cells produce exosomes carrying tissue-restricted antigens. | No abstract available |
| 28211531 | Proteomic analysis of urinary extracellular vesicles from high Gleason score prostate cancer. | No abstract available |
| 28240915 | Quantitative Proteomic Analysis of Serum Exosomes from Patients with Locally Advanced Pancreatic Cancer Undergoing Chemoradiotherapy. | No abstract available |
| 28914500 | Comprehensive proteomics analysis of exosomes derived from human seminal plasma. | No abstract available |
| 29441425 | Detailed analysis of the plasma extracellular vesicle proteome after separation from lipoproteins. | No abstract available |
| 31414377 | Global extracellular vesicle proteomic signature defines U87-MG glioma cell hypoxic status with potential implications for non-invasive diagnostics. | No abstract available |
| 31718609 | Ovarian cancer circulating extracelluar vesicles promote coagulation and have a potential in diagnosis: an iTRAQ based proteomic analysis. | No abstract available |
| 32331267 | Mass Spectrometry-Based Proteomic Characterization of Cutaneous Melanoma Ectosomes Reveals the Presence of Cancer-Related Molecules. | No abstract available |
| 33169421 | A novel method of high-purity extracellular vesicle enrichment from microliter-scale human serum for proteomic analysis. | No abstract available |
| 34202855 | Proteomic Profiling of Ectosomes Derived from Paired Urothelial Bladder Cancer and Normal Cells Reveals the Presence of Biologically-Relevant Molecules. | No abstract available |