Protein detail
FCERG
High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
Entry name FCERG | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count 1 | Protein classification FDA approved drug targetsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
Protein Class (2)
FDA approved drug targetsPredicted membrane proteins
Protein Function
FDA approved drug targets:Small molecule drugs
Transmembrane
24..44; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
FcepsilonRIgamma
Gene Description
Fc epsilon receptor Ig
Chromosome
1
Position
161215234-161220699
EVMP confidence score
0.38
Fluorescence & Localization2
Cell SpecificEsophageal apical cellsSingle-Nuclei Brain Specificfibroblast
Function & Pathway7
Protein Function
FDA approved drug targets:Small molecule drugs
Cellular Component (7)
Molecular Function (6)
Biological Process (3)
KEGG (8)
- hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04625 C-type lectin receptor signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05310 Asthma
Reactome (14)
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-5621480 dectin 2 family
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2871837 fceri mediated nf kb activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence36
Enzyme-Mediated Modification (9)
9 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FCER1G | SRC | P12931 | Y | 65 | phosphorylation | Li2012 | |
| FCER1G | SRC | P12931 | Y | 76 | phosphorylation | Li2012 | |
| FCER1G | PRKCD | Q05655 | S | 69 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| FCER1G | PRKACA | P17612 | S | 69 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| FCER1G | PRKCB | P05771 | S | 69 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| FCER1G | LYN | P07948 | Y | 76 | phosphorylation | Reactome_ProtMapperProtMapper | |
| FCER1G | LYN | P07948 | Y | 65 | phosphorylation | Reactome_ProtMapperProtMapper | |
| FCER1G | FYN | P06241 | Y | 76 | phosphorylation | Reactome_ProtMapperProtMapper | |
| FCER1G | FYN | P06241 | Y | 65 | phosphorylation | Reactome_ProtMapperProtMapper |
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
Page 1 of 3Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KAPCA | P17612 | FCERG | P30273 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:27630214 |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains8
Sequences
Length
86
Mass
9,667
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
3D Structural Models
Helix
23..51
3D Structure
Electron microscopy (2); X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
54..82; ITAM
Protein Families
CD3Z/FCER1G family
Sequence Similarities
Belongs to the CD3Z/FCER1G family.
Clinical Relevance7
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Interaction Protein
ENSG00000165025
Interaction Count
1
Interaction Dataset
intact_biogrid