Protein detail
HLAF
HLA class I histocompatibility antigen, alpha chain F (CDA12) (HLA F antigen) (Leukocyte antigen F) (MHC class I antigen F)
Entry name HLAF | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information7
Protein Names
HLA class I histocompatibility antigen, alpha chain F (CDA12) (HLA F antigen) (Leukocyte antigen F) (MHC class I antigen F)
Transmembrane
306..329; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization4
Tissue SpecificesophagusBrain Regional Specificchoroid plexusCell SpecificBreast secretory cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway6
Cellular Component (15)
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005765 lysosomal membrane
- GO:0005783 endoplasmic reticulum
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030670 phagocytic vesicle membrane
Page 1 of 2
Molecular Function (7)
Biological Process (3)
KEGG (18)
- hsa04144 Endocytosis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
Page 1 of 2
Reactome (16)
- R-hsa-1280218 adaptive immune system
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-909733 interferon alpha beta signaling
- R-hsa-877300 interferon gamma signaling
Page 1 of 2
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | Yes | No |
| ecm | ecm | OmniPath | Yes | No | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | Yes | No |
Page 1 of 4Next
Protein Complex Composition (1)
Sequence, Structure & Domains14
Sequences
Length
346
Mass
39,062
Sequence
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P30511-1; Sequence=Displayed; Name=2; IsoId=P30511-2; Sequence=VSP_038846; Name=3; IsoId=P30511-3; Sequence=VSP_040349
Alternative Sequence
204..295; Missing (in isoform 2); 346; V -> AYSVVSGNLMITWWSSLFLLGVLFQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGFGFRRGRSFLLRSWHHLMKRVQIKIFD (in isoform 3)
3D Structural Models
Turn
36..38; 246..248
Helix
71..73; 78..105; 161..170; 173..182; 184..195; 197..200; 275..277
Beta Strand
24..35; 39..49; 52..58; 61..63; 67..70; 115..124; 128..139; 142..147; 154..158; 207..214; 216..232; 235..240; 249..251; 258..260; 262..271; 278..283; 287..289; 291..293
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Motif
336..338; Sorting signal sequence; Golgi-retention signal; ER-retention signal
Domain (FT)
206..296; Ig-like C1-type
Region
22..111; Alpha-1; 112..203; Alpha-2; 204..295; Alpha-3; 296..305; Connecting peptide
Protein Families
MHC class I family
Sequence Similarities
Belongs to the MHC class I family.
Clinical Relevance1
Drugs (2)
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 40689422 | Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles. | No abstract available |