Protein detail
AA1R
Adenosine receptor A1
Entry name AA1R | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 7 | Protein classification FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Adenosine receptor A1
Protein Class (4)
FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters
Protein Function (4)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- Transporters
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
12..32; Helical; Name=1; 48..68; Helical; Name=2; 78..98; Helical; Name=3; 128..147; Helical; Name=4; 174..196; Helical; Name=5; 237..259; Helical; Name=6; 268..289; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
RDC7
Gene Description
Adenosine A1 receptor
Chromosome
1
Position
203090654-203167405
Supporting publications (n)
6
EVMP confidence score
0.63
Function & Pathway
Protein Function (4)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- Transporters
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (13)
- GO:0005886 plasma membrane
- GO:0016323 basolateral plasma membrane
- GO:0030425 dendrite
- GO:0030673 axolemma
- GO:0032279 asymmetric synapse
- GO:0042734 presynaptic membrane
- GO:0043025 neuronal cell body
- GO:0043195 terminal bouton
- GO:0043197 dendritic spine
- GO:0044305 calyx of Held
Page 1 of 2
Molecular Function (8)
- GO:0001609 G protein-coupled adenosine receptor activity
- GO:0001664 G protein-coupled receptor binding
- GO:0001883 purine nucleoside binding
- GO:0005515 protein binding
- GO:0031072 heat shock protein binding
- GO:0031683 G-protein beta/gamma-subunit complex binding
- GO:0032795 heterotrimeric G-protein binding
- GO:0046982 protein heterodimerization activity
Biological Process (3)
KEGG (8)
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04080 Neuroactive ligand-receptor interaction
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04923 Regulation of lipolysis in adipocytes
- KEGG:hsa04924 Renin secretion
- KEGG:hsa05032 Morphine addiction
Reactome (5)
Canonical Pathways (2)
- M12771 Sa pten pathway
- M86 Pid arf6 pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence62
Ligand-Receptor Signaling (55)
55 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | EMBRACE | Yes | Yes | |||
| gpcr | receptor | GPCRdb | Yes | Yes | |||
| adenosine | receptor | HGNC | Yes | Yes | |||
| receptor | receptor | HGNC | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 6 of 6Previous
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AA1R | P30542 | GNAI3 | P08754 | Yes | Yes | WangCui2007SIGNORCA1 | CA1:6305455CA1:6162091CA1:3805010SIGNOR:31160049 | |
| ADA | P00813 | AA1R | P30542 | Yes | Yes | HPRDSPIKE_LCSIGNOR | HPRD:12150791HPRD:9247966SIGNOR:18680557SPIKE_LC:16713569 | |
| AA1R | P30542 | GNAZ | P19086 | Yes | Yes | HPRDSPIKE_LCSIGNOR | HPRD:9166747SPIKE_LC:16713569SIGNOR:31160049 | |
| AA1R | P30542 | GNAO | P09471 | Yes | Yes | HPRDSPIKE_LCSIGNOR | SPIKE_LC:16713569HPRD:10521440SIGNOR:31160049 | |
| AA1R | P30542 | GNAI1 | P63096 | Yes | Yes | SIGNOR | SIGNOR:31160049 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38321535 |
Sequence, Structure & Domains
Sequences
Length
326
Mass
36,512
Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P30542-1; Sequence=Displayed; Name=2; IsoId=P30542-2; Sequence=VSP_034401, VSP_034402
Alternative Sequence
115..125; YKMVVTPRRAA -> RISQCMASTKS (in isoform 2); 126..326; Missing (in isoform 2)
3D Structural Models
Turn
112..114
Helix
7..36; 38..40; 43..60; 62..71; 77..110; 115..118; 121..140; 141..144; 149..159; 171..174; 177..182; 184..188; 190..211; 228..259; 267..291; 293..306
Beta Strand
74..76; 166..168
3D Structure
Electron microscopy (3); X-ray crystallography (2)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Related Diseases (19)
Acute diabetic complicationAllergic/hypersensitivity disorderCardiac arrhythmiaCardiovascular diseaseDiabetes mellitusGeneral pain disorderGlaucomaHeart failureHyper-lipoproteinaemiaHypertensionIschaemic heart diseaseIschaemic/haemorrhagic strokeKidney failureMild neurocognitive disorderMultiple sclerosisOrthostatic hypotensionParkinsonismSepsisSupraventricular tachyarrhythmia
Biomarker
Discontinued in Phase 1; Discontinued in Phase 2; Phase 2; Discontinued in Phase 3; Phase 1/2; Phase 3; Preclinical; Phase 1; Terminated; Approved; Investigative
Drug Targets
FDA approved drug targets
Drugs (35)
CHEMBL:CHEMBL27508NAXIFYLLINEPBF-680SCH442416ASPIRINGS9667TRABODENOSONBAY1067197THEOPHYLLINEOXTRIPHYLLINEDERENOFYLLINECHROMOCARBSELODENOSONCAFFEINETHEOPHYLLINE SODIUM GLYCINATELUF 5962TECADENOSONNELADENOSONCAPADENOSONADENOSINET-62CHEMBL:CHEMBL59532APAXIFYLLINEGW493838RPR749PENTOXIFYLLINEROLOFYLLINECHEMBL:CHEMBL303124AMP579AMINOPHYLLINETONAPOFYLLINEGS-9667CAFFEINE CITRATEFK-453CHEMBL:CHEMBL1950650
Interaction Protein
ENSG00000165409
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 39104279 | A Predictive Model for Initial Platinum-Based Chemotherapy Efficacy in Patients with Postoperative Epithelial Ovarian Cancer Using Tissue-Derived Small Extracellular Vesicles. | No related sentences available |
| 39290459 | Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease. | No related sentences available |
| 39443544 | Profiling of urinary extracellular vesicle protein signatures from patients with cribriform and intraductal prostate carcinoma in a cross-sectional study. | No related sentences available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No related sentences available |