Protein detail
CEAM8
Cell adhesion molecule CEACAM8 (CD67 antigen) (Carcinoembryonic antigen CGM6) (Carcinoembryonic antigen-related cell adhesion molecule 8) (CEA cell adhesion molecule 8) (Non-specific cross-reacting antigen NCA-95) (CD antigen CD66b)
Entry name CEAM8 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 6 | Transmembrane count | Protein classification CD markersPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Cell adhesion molecule CEACAM8 (CD67 antigen) (Carcinoembryonic antigen CGM6) (Carcinoembryonic antigen-related cell adhesion molecule 8) (CEA cell adhesion molecule 8) (Non-specific cross-reacting antigen NCA-95) (CD antigen CD66b)
Protein Class (3)
CD markersPlasma proteinsPredicted intracellular proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD66bCGM6
Gene Description
CEA cell adhesion molecule 8
Chromosome
19
Position
42580243-42595055
Supporting publications (n)
6
EVMP confidence score
0.38
Fluorescence & Localization6
Tissue SpecificbreastBrain Regional Specificchoroid plexusCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component (8)
Molecular Function (2)
Biological Process (3)
Reactome (6)
Canonical Pathways (3)
- M47 Pid integrin cs pathway
- M69 Pid reelin pathway
- M196 Pid il23 pathway
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence25
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | No | No | Yes |
| intracellular | intracellular | GO_Intercell | No | No | No | No | Yes |
| intracellular | intracellular | OmniPath | No | No | No | No | Yes |
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | No | No | No | Yes |
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | No | No | No | Yes |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | No | Yes |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | No | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | Yes |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | Yes |
Page 1 of 3Next
Sequence, Structure & Domains11
Sequences
Length
349
Mass
38,154
Sequence
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
3D Structural Models
Turn
84..87; 127..129
Helix
75..77; 114..116
Beta Strand
37..46; 51..56; 64..72; 78..83; 88..91; 99..101; 107..109; 118..125; 131..141
3D Structure
NMR spectroscopy (1); X-ray crystallography (3)
Domain & Motif Annotations
Domain (CC)
The N-terminus Ig-like V-type domain is necessary for heterophilic intercellular adhesion.
Domain (FT)
35..142; Ig-like V-type; 145..232; Ig-like C2-type 1; 237..319; Ig-like C2-type 2
Protein Families (2)
- Immunoglobulin superfamily
- CEA family
Sequence Similarities
Belongs to the immunoglobulin superfamily. CEA family.
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 32284825 | Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. | No abstract available |
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 39940923 | NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles. | No abstract available |