Protein detail
CCKAR
Cholecystokinin receptor type A (CCK-A receptor) (CCK-AR) (Cholecystokinin-1 receptor) (CCK1-R)
Entry name CCKAR | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cholecystokinin receptor type A (CCK-A receptor) (CCK-AR) (Cholecystokinin-1 receptor) (CCK1-R)
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
42..67; Helical; Name=1; 78..104; Helical; Name=2; 116..137; Helical; Name=3; 158..178; Helical; Name=4; 211..234; Helical; Name=5; 314..334; Helical; Name=6; 350..373; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificDifferentiating spermatogoniaBlood Cell SpecificT-regBlood Lineage SpecificT-cells
Function & Pathway
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
KEGG (5)
Reactome (5)
Canonical Pathways (3)
- M274 Pid lymph angiogenesis pathway
- M47 Pid integrin cs pathway
- M165 Pid syndecan 4 pathway
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence70
Ligand-Receptor Signaling (55)
55 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr | receptor | Almen2009 | Yes | Yes | |||
| rhodopsin | receptor | Almen2009 | Yes | Yes | |||
| gpcr | receptor | UniProt_keyword | Yes | Yes | |||
| seven_transmembrane_7tm | receptor | HPMR | Yes | Yes | |||
| 7tm_a | receptor | HPMR | Yes | Yes | |||
| endothelin_gastrin_releasing_peptide_7tm_a | receptor | HPMR | Yes | Yes | |||
| rhodopsin | receptor | Surfaceome | Yes | Yes | |||
| gpcr | receptor | Surfaceome | Yes | Yes | |||
| class_a_rhodopsin | receptor | GPCRdb | Yes | Yes | |||
| class_a_rhodopsin_peptide | receptor | GPCRdb | Yes | Yes |
Regulatory Interaction Network (14)
14 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CCKAR | P32238 | GNA15 | P30679 | Yes | Yes | WangSIGNOR | SIGNOR:31160049 | |
| CCKAR | P32238 | GNAL | P38405 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| CCKAR | P32238 | GNA14 | O95837 | Yes | Yes | WangSIGNOR | SIGNOR:31160049 | |
| CCKAR | P32238 | GNAS3 | O95467 | Yes | Yes | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 | |
| CCKAR | P32238 | ALEX | P84996 | Yes | Yes | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 | |
| CCKAR | P32238 | GNAS2 | P63092 | Yes | Yes | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 | |
| CCKAR | P32238 | GNAS1 | Q5JWF2 | Yes | Yes | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 | |
| CCKAR | P32238 | GNAQ | P50148 | Yes | Yes | WangSIGNOR | SIGNOR:11313903SIGNOR:31160049 | |
| CCKAR | P32238 | GNA13 | Q14344 | Yes | Yes | SIGNOR | SIGNOR:12853286 | |
| CCKAR | P32238 | GNA12 | Q03113 | Yes | Yes | SIGNOR | SIGNOR:12853286 |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry;Western blotting;RNA Sequencing;Small RNA sequencing (Illumina HiSeq 2000) | 1 | 40748658 |
Sequence, Structure & Domains
Sequences
Length
428
Mass
47,841
Sequence
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ
3D Structural Models
Turn
5..11; 371..373; 382..384
Helix
40..68; 70..72; 75..104; 111..144; 146..152; 155..172; 175..179; 188..190; 203..217; 219..242; 304..338; 340..347; 350..360; 362..370; 375..381
Beta Strand
13..15; 21..25; 180..186; 192..198
3D Structure
Electron microscopy (9); NMR spectroscopy (2); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
411..422; Polar residues
Region
248..272; Disordered; 394..428; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (8)
Biomarker
Preclinical; Terminated; Discontinued in Phase 2; Phase 2
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No related sentences available |