Protein detail
CCKAR
Cholecystokinin receptor type A (CCK-A receptor) (CCK-AR) (Cholecystokinin-1 receptor) (CCK1-R)
Protein symbol CCKAR | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 7 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Cholecystokinin receptor type A (CCK-A receptor) (CCK-AR) (Cholecystokinin-1 receptor) (CCK1-R)
Protein Function
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
42..67; Helical; Name=1; 78..104; Helical; Name=2; 116..137; Helical; Name=3; 158..178; Helical; Name=4; 211..234; Helical; Name=5; 314..334; Helical; Name=6; 350..373; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificDifferentiating spermatogoniaBlood Cell SpecificT-regBlood Lineage SpecificT-cells
Function & Pathway
Protein Function
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Biological Process
KEGG
Reactome
Canonical Pathways
- M274 Pid lymph angiogenesis pathway
- M47 Pid integrin cs pathway
- M165 Pid syndecan 4 pathway
Mediation Categories
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
55 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network
14 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CCKAR | P32238 | GNA15 | P30679 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| CCKAR | P32238 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| CCKAR | P32238 | GNA14 | O95837 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| CCKAR | P32238 | GNAS3 | O95467 | Yes | Yes | No | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 |
| CCKAR | P32238 | ALEX | P84996 | Yes | Yes | No | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 |
| CCKAR | P32238 | GNAS2 | P63092 | Yes | Yes | No | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 |
| CCKAR | P32238 | GNAS1 | Q5JWF2 | Yes | Yes | No | HINTSIGNOR | SIGNOR:31160049HINT:34086670HINT:35672283 |
| CCKAR | P32238 | GNAQ | P50148 | Yes | Yes | No | WangSIGNOR | SIGNOR:11313903SIGNOR:31160049 |
| CCKAR | P32238 | GNA13 | Q14344 | Yes | Yes | No | SIGNOR | SIGNOR:12853286 |
| CCKAR | P32238 | GNA12 | Q03113 | Yes | Yes | No | SIGNOR | SIGNOR:12853286 |
Page 1 of 2Next
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry；Western blotting；RNA Sequencing；Small RNA sequencing (Illumina HiSeq 2000) | 1 | 40748658 |
Sequence, Structure & Domains
Sequences
Length
428
Mass
47,841
Sequence
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ
3D Structural Models
Turn
5..11; 371..373; 382..384
Helix
40..68; 70..72; 75..104; 111..144; 146..152; 155..172; 175..179; 188..190; 203..217; 219..242; 304..338; 340..347; 350..360; 362..370; 375..381
Beta Strand
13..15; 21..25; 180..186; 192..198
3D Structure
Electron microscopy (9); NMR spectroscopy (2); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
411..422; Polar residues
Region
248..272; Disordered; 394..428; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases
Biomarker
Preclinical; Terminated; Discontinued in Phase 2; Phase 2