Protein detail
CCR7
C-C chemokine receptor type 7 (C-C CKR-7) (CC-CKR-7) (CCR-7) (BLR2) (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor) (CD antigen CD197)
Entry name CCR7 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification Cancer-related genesCD markersG-protein coupled receptorsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
C-C chemokine receptor type 7 (C-C CKR-7) (CC-CKR-7) (CCR-7) (BLR2) (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor) (CD antigen CD197)
Protein Class (4)
Cancer-related genesCD markersG-protein coupled receptorsPredicted membrane proteins
Protein Function (4)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
60..86; Helical; Name=1; 96..116; Helical; Name=2; 131..152; Helical; Name=3; 171..191; Helical; Name=4; 220..247; Helical; Name=5; 264..289; Helical; Name=6; 314..331; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BLR2CD197CDw197CMKBR7EBI1
Gene Description
C-C motif chemokine receptor 7
Chromosome
17
Position
40553769-40565472
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization3
Tissue SpecificintestineCell SpecificEnterocytes
Function & Pathway8
Protein Function (4)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (4)
Molecular Function (6)
Biological Process (3)
KEGG (3)
Reactome (6)
Canonical Pathways (3)
- M47 Pid integrin cs pathway
- M67 Pid arf6 trafficking pathway
- M18 Pid integrin1 pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence75
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CCR7 | SRC | P12931 | Y | 155 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper |
Ligand-Receptor Signaling (69)
69 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HGNC | No | Yes | No | Yes | No |
| receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellChatDB | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | Kirouac2010 | No | Yes | No | Yes | No |
Page 1 of 7Next
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CCL19 | Q99731 | CCR7 | P32248 | Yes | Yes | No | iTALKKirouac2010Guide2Pharma_LRdbICELLNETSIGNORCellPhoneDB_CellinkerInnateDBDIPHPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrscConnectHPRDRamilowski2015_Baccin2019DLRP_talklrGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrCellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | Guide2Pharma:9153236InnateDB:15546958connectomeDB2020:11342595HPMR:11342595LRdb:10699158DIP:9507024connectomeDB2020:9507024Guide2Pharma:9507024Baccin2019:9153236Guide2Pharma:16904643InnateDB:9153236Cellinker:9153236Cellinker:11342595scConnect:10512740Guide2Pharma:10512740Cellinker:9507024scConnect:16904643SIGNOR:19497875connectomeDB2020:9153236DIP:9153236ICELLNET:22633458CellTalkDB:24218476Baccin2019:11342595HPRD:9153236scConnect:9153236scConnect:9507024Baccin2019:9507024 |
| CCL21 | O00585 | CCR7 | P32248 | Yes | Yes | No | iTALKKirouac2010Guide2Pharma_LRdbICELLNETSIGNORHINTCellPhoneDB_CellinkerInnateDBDIPHPMR_talklrCellChatDBHPRD_LRdbDLRP_CellinkertalklrscConnectHPRDRamilowski2015_Baccin2019DLRP_talklrGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrCellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020SPIKE_LCLRdb | Baccin2019:9585422HPRD:9585422CellTalkDB:10699158LRdb:10699158DIP:9507024Cellinker:9585422connectomeDB2020:9507024Guide2Pharma:9507024connectomeDB2020:9585422Cellinker:11970971connectomeDB2020:11970971InnateDB:22221265Cellinker:9507024InnateDB:9507024ICELLNET:22633458HINT:9585422Baccin2019:11970971HINT:9507024HPRD:9507024DIP:10488147SIGNOR:11970971scConnect:9507024SPIKE_LC:16713569Baccin2019:9507024 |
| CCR7 | P32248 | ARRB2 | P32121 | Yes | Yes | No | WangSIGNOR | SIGNOR:15054093 |
| SRC | P12931 | CCR7 | P32248 | Yes | No | No | Sparser_ProtMapperiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:31644919PhosphoSite:26789922ProtMapper:33841445 |
Sequence, Structure & Domains8
Sequences
Length
378
Mass
42,874
Sequence
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
3D Structural Models
Helix
56..84; 85..89; 92..108; 111..119; 125..157; 168..171; 173..190; 191..195; 221..231; 233..247
Beta Strand
196..200; 209..212
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance4
Disease Involvement
Cancer-related genes
Related Diseases (2)
Biomarker
Phase 1
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |