Protein detail
CD80
T-lymphocyte activation antigen CD80 (Activation B7-1 antigen) (BB1) (CTLA-4 counter-receptor B7.1) (B7) (CD antigen CD80)
Entry name CD80 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersFDA approved drug targetsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
T-lymphocyte activation antigen CD80 (Activation B7-1 antigen) (BB1) (CTLA-4 counter-receptor B7.1) (B7) (CD antigen CD80)
Protein Class (4)
CD markersFDA approved drug targetsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- CD markers
- Predicted intracellular proteins
- FDA approved drug targets:Biotech drugs
Transmembrane
243..263; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
B7-1B7.1CD28LGCD28LG1
Gene Description
CD80 molecule
Chromosome
3
Position
119524293-119559614
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization5
Tissue SpecificbrainCell SpecificAstrocytesSingle-Nuclei Brain SpecificastrocyteSecretome LocationIntracellular and membraneSecretome FunctionDevelopmental protein
Function & Pathway8
Protein Function (3)
- CD markers
- Predicted intracellular proteins
- FDA approved drug targets:Biotech drugs
Cellular Component (4)
Molecular Function (4)
Biological Process (3)
KEGG (12)
- hsa03267 Virion - Adenovirus
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04620 Toll-like receptor signaling pathway
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05322 Systemic lupus erythematosus
- KEGG:hsa05323 Rheumatoid arthritis
- KEGG:hsa05330 Allograft rejection
Page 1 of 2
Reactome (14)
- R-hsa-1280218 adaptive immune system
- R-hsa-389357 cd28 dependent pi3k akt signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-389513 co inhibition by ctla4
- R-hsa-389356 co stimulation by cd28
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-6783783 interleukin 10 signaling
- R-hsa-9006925 intracellular signaling by second messengers
Page 1 of 2
Canonical Pathways (3)
- M212 Pid integrin5 pathway
- M47 Pid integrin cs pathway
- M174 Pid upa upar pathway
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence58
Ligand-Receptor Signaling (56)
56 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Baccin2019 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| ligand | ligand | iTALK | Yes | No | No | Yes | No |
| ligand | ligand | GO_Intercell | Yes | No | No | Yes | No |
| ligand | ligand | ICELLNET | Yes | No | No | Yes | No |
| ligand | ligand | LRdb | Yes | No | No | Yes | No |
| checkpoint | ligand | ICELLNET | Yes | No | No | Yes | No |
| checkpoint_b7 | ligand | ICELLNET | Yes | No | No | Yes | No |
| ligand | ligand | OmniPath | Yes | No | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blottingMass spectrometryMass spectrometry [LTQ-FT Ultra]R Sequencing | 1 | 22624035 |
Sequence, Structure & Domains10
Sequences
Length
288
Mass
33,048
Sequence
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P33681-1; Sequence=Displayed; Name=2; Synonyms=s1CD80; IsoId=P33681-2; Sequence=VSP_047700; Name=3; Synonyms=s2CD80; IsoId=P33681-3; Sequence=VSP_047698, VSP_047699
Alternative Sequence
140; A -> G (in isoform 3); 141..266; Missing (in isoform 3); 234..266; TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC -> S (in isoform 2)
3D Structural Models
Turn
96..99; 193..195
Helix
58..61; 85..87; 108..110
Beta Strand
37..41; 46..48; 62..68; 71..77; 80..83; 88..90; 92..95; 100..105; 112..122; 125..139; 146..151; 157..169; 171..179; 185..191; 198..207; 212..220; 225..231
3D Structure
Electron microscopy (3); X-ray crystallography (3)
Domain & Motif Annotations
Domain (FT)
35..135; Ig-like V-type; 145..230; Ig-like C2-type
Clinical Relevance9
Disease Involvement
FDA approved drug targets
Related Diseases (6)
Biomarker
Phase 1; Phase 2; Approved; Terminated
Drug Targets
FDA approved drug targets
Drugs (13)
Interaction Protein
ENSG00000163599
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |