Protein detail
SDC2
Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
Entry name SDC2 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
Protein Class
CD markersPredicted membrane proteins
Protein Function
CD markers
Transmembrane
145..169; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD362fibroglycanHSPGHSPG1SYND2
Gene Description
Syndecan 2
Chromosome
8
Position
96493813-96611790
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificcerebellar inhibitory
Function & Pathway
Protein Function
CD markers
Cellular Component
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-9694614 attachment and entry
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-3560783 defective b4galt7 causes eds progeroid type
- R-hsa-3656237 defective ext2 causes exostoses 2
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-3560782 diseases associated with glycosaminoglycan metabolism
- R-hsa-3781865 diseases of glycosylation
- R-hsa-5668914 diseases of metabolism
- R-hsa-9772572 early sars cov 2 infection events
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-1474244 extracellular matrix organization
- R-hsa-1630316 glycosaminoglycan metabolism
- R-hsa-1971475 glycosaminoglycan protein linkage region biosynthesis
- R-hsa-109582 hemostasis
- R-hsa-1638091 heparan sulfate heparin hs gag metabolism
- R-hsa-2022928 hs gag biosynthesis
- R-hsa-2024096 hs gag degradation
- R-hsa-5663205 infectious disease
- R-hsa-71387 metabolism of carbohydrates and carbohydrate derivatives
- R-hsa-6806667 metabolism of fat soluble vitamins
- R-hsa-196854 metabolism of vitamins and cofactors
- R-hsa-9675108 nervous system development
- R-hsa-3000171 non integrin membrane ecm interactions
- R-hsa-597592 post translational protein modification
- R-hsa-381426 regulation of insulin like growth factor igf transport and uptake by insulin like growth factor binding proteins igfbps
- R-hsa-9820952 respiratory syncytial virus infection pathway
- R-hsa-9820960 respiratory syncytial virus rsv attachment and entry
- R-hsa-9833110 rsv host interactions
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-9709957 sensory perception
- R-hsa-3000170 syndecan interactions
- R-hsa-9824446 viral infection pathways
- R-hsa-2187338 visual phototransduction
Mediation Categories
Clinical-translation mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
17 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SDC2 | PRKCB | P05771 | S | 187 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:9244383KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD:19901323 |
| SDC2 | PRKCB | P05771 | S | 188 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:9244383KEA:9244383ProtMapper:9244383SIGNOR:9244383KEA:17570479HPRD:19901323 |
| SDC2 | PRKCG | P05129 | S | 188 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:9244383KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD:19901323 |
| SDC2 | PRKCG | P05129 | S | 187 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:9244383KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD:19901323 |
| SDC2 | PRKCA | P17252 | S | 187 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:9244383KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD:19901323 |
| SDC2 | PRKCA | P17252 | S | 188 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:9244383KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD:19901323 |
| SDC2 | SRC | P12931 | Y | 179 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| SDC2 | PRKCD | Q05655 | S | 187 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| SDC2 | PRKCD | Q05655 | S | 188 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| SDC2 | PRKCE | Q02156 | S | 187 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP |
Page 1 of 2Next
Ligand-Receptor Signaling
76 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellChatDB | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| syndecan | receptor | Almen2009 | No | Yes | No | Yes | No |
| growth_factor | receptor | Baccin2019 | No | Yes | No | Yes | No |
Page 1 of 8Next
Regulatory Interaction Network
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCB | P05771 | SDC2 | P34741 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phosNetworKIN_KEA | HPRD:9244383HPRD-phos:9244383ProtMapper:19901323KEA:9244383ProtMapper:9244383SIGNOR:9244383KEA:17570479HPRD-phos:19901323 |
| KPCG | P05129 | SDC2 | P34741 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:9244383HPRD-phos:9244383ProtMapper:19901323KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD-phos:19901323 |
| KPCA | P17252 | SDC2 | P34741 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:9244383HPRD-phos:9244383ProtMapper:19901323KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD-phos:19901323 |
| SRC | P12931 | SDC2 | P34741 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperWangPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:16997272 |
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster284 | HADHBSDC1SDC2SDC3SDC4 | O75056P18827P31431P34741P55084 | 1:1:1:1:1 | Compleat | Compleat:HC2235 | 22036573 |
| CHD1PHIPSDC2TMPO | O14646P34741P42166Q8WWQ0 | 0:0:0:0 | hu.MAP | |||
| CHD1PHIPSDC2TMPO | O14646P34741P42167Q8WWQ0 | 0:0:0:0 | hu.MAP | |||
| DHRS2NBEAL1SDC2 | P34741Q13268Q6ZS30 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Western BlottingImmunoelectron MicroscopyFlow CytometryElisa | 1 | 37387557 |
Sequence, Structure & Domains
Sequences
Length
201
Mass
22,160
Sequence
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
3D Structural Models
Helix
143..171
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
90..102; Polar residues; 103..123; Basic and acidic residues
Region
42..70; Disordered; 90..130; Disordered; 178..201; Disordered
Protein Families
Syndecan proteoglycan family
Sequence Similarities
Belongs to the syndecan proteoglycan family.
Clinical Relevance
Drugs
Interaction Protein
ENSG00000147044
Interaction Count
1
Interaction Dataset
intact_biogrid