Protein detail
SDC2
Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
Entry name SDC2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
Protein Class (2)
CD markersPredicted membrane proteins
Protein Function
CD markers
Transmembrane
145..169; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD362fibroglycanHSPGHSPG1SYND2
Gene Description
Syndecan 2
Chromosome
8
Position
96493813-96611790
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificcerebellar inhibitory
Function & Pathway7
Protein Function
CD markers
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
KEGG (5)
Reactome (37)
- R-hsa-9694614 attachment and entry
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-3560783 defective b4galt7 causes eds progeroid type
- R-hsa-3656237 defective ext2 causes exostoses 2
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-3560782 diseases associated with glycosaminoglycan metabolism
- R-hsa-3781865 diseases of glycosylation
- R-hsa-5668914 diseases of metabolism
Page 1 of 4
Mediation Categories (3)
Clinical-translation mediationImmune mediationMetabolism mediation
Relations & Evidence102
Enzyme-Mediated Modification (17)
17 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SDC2 | PRKCE | Q02156 | S | 188 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| SDC2 | PRRT2 | Q7Z6L0 | S | 188 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:9244383ProtMapper:12507425ProtMapper:8528141 |
| SDC2 | PRRT2 | Q7Z6L0 | S | 187 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:9244383ProtMapper:12507425ProtMapper:8528141 |
| SDC2 | EPHB2 | P29323 | Y | 200 | phosphorylation | NCI-PID_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:16198615ProtMapper:11580899 |
| SDC2 | EPHB2 | P29323 | Y | 191 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:16198615ProtMapper:11580899 |
| SDC2 | HRAS | P01112 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15752734ProtMapper:16997272 |
| SDC2 | RPS6KA3 | P51812 | S | 187 | phosphorylation | KEA | KEA:17570479 |
Page 2 of 2Previous
Ligand-Receptor Signaling (76)
76 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | No |
| adhesion | adhesion | MCAM | Yes | Yes | No | Yes | No |
| adhesion | adhesion | Adhesome | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | No | Yes | No |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | No | Yes | No |
| matrix_adhesion | matrix_adhesion | Cellinker | No | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| matrix_adhesion | matrix_adhesion | OmniPath | No | Yes | No | Yes | No |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCB | P05771 | SDC2 | P34741 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phosNetworKIN_KEA | HPRD:9244383HPRD-phos:9244383ProtMapper:19901323KEA:9244383ProtMapper:9244383SIGNOR:9244383KEA:17570479HPRD-phos:19901323 |
| KPCG | P05129 | SDC2 | P34741 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:9244383HPRD-phos:9244383ProtMapper:19901323KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD-phos:19901323 |
| KPCA | P17252 | SDC2 | P34741 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:9244383HPRD-phos:9244383ProtMapper:19901323KEA:9244383ProtMapper:9244383SIGNOR:9244383HPRD-phos:19901323 |
| SRC | P12931 | SDC2 | P34741 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperWangPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:16997272 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster284 | HADHBSDC1SDC2SDC3SDC4 | O75056P18827P31431P34741P55084 | 1:1:1:1:1 | Compleat | Compleat:HC2235 | 22036573 |
| CHD1PHIPSDC2TMPO | O14646P34741P42166Q8WWQ0 | 0:0:0:0 | hu.MAP | |||
| CHD1PHIPSDC2TMPO | O14646P34741P42167Q8WWQ0 | 0:0:0:0 | hu.MAP | |||
| DHRS2NBEAL1SDC2 | P34741Q13268Q6ZS30 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Western BlottingImmunoelectron MicroscopyFlow CytometryElisa | 1 | 37387557 |
Sequence, Structure & Domains9
Sequences
Length
201
Mass
22,160
Sequence
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
3D Structural Models
Helix
143..171
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
90..102; Polar residues; 103..123; Basic and acidic residues
Region
42..70; Disordered; 90..130; Disordered; 178..201; Disordered
Protein Families
Syndecan proteoglycan family
Sequence Similarities
Belongs to the syndecan proteoglycan family.
Clinical Relevance5
Drugs
Interaction Protein
ENSG00000147044
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |