Protein detail

5HT7R

5-hydroxytryptamine receptor 7 (5-HT-7) (5-HT7) (5-HT-X) (Serotonin receptor 7)

Entry name 5HT7R	UniProt ID P34969	EVMP confidence score 0.53
Supporting publications (n) 2	Transmembrane count 7	Protein classification FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsRAS pathway related proteins

Basic Information

Protein Names

5-hydroxytryptamine receptor 7 (5-HT-7) (5-HT7) (5-HT-X) (Serotonin receptor 7)

Protein Class (4)

FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsRAS pathway related proteins

Protein Function (4)

G-protein coupled receptors:Serotonin receptors
FDA approved drug targets:Small molecule drugs
RAS pathway related proteins
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

84..108; Helical; Name=1; 119..140; Helical; Name=2; 153..178; Helical; Name=3; 199..219; Helical; Name=4; 238..260; Helical; Name=5; 327..352; Helical; Name=6; 364..387; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000148680

Entrez Gene Symbol

HTR7

Gene Synonym

5-HT7

Gene Description

5-hydroxytryptamine receptor 7

Chromosome

Position

90740823-90858039

Supporting publications (n)

EVMP confidence score

0.53

Fluorescence & Localization

Cell SpecificEnterocytes

Function & Pathway

Protein Function (4)

G-protein coupled receptors:Serotonin receptors
FDA approved drug targets:Small molecule drugs
RAS pathway related proteins
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

KEGG (5)

Reactome (8)

Canonical Pathways (2)

M212 Pid integrin5 pathway
M47 Pid integrin cs pathway

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence55

Ligand-Receptor Signaling (43)

43 records.

Category	Parent	Database	Receiver	Plasma Membrane (Transmembrane)
plasma_membrane	plasma_membrane	UniProt_location		Yes
plasma_membrane	plasma_membrane	OmniPath		Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR		Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath		Yes
cell_surface	cell_surface	Surfaceome		Yes
cell_surface	cell_surface	OmniPath		Yes
receptor	receptor	scConnect	Yes	Yes
receptor	receptor	iTALK	Yes	Yes
receptor	receptor	CellCellInteractions	Yes	Yes
gpcr	receptor	GPCRdb	Yes	Yes

Page 4 of 5Previous Next

Regulatory Interaction Network (11)

11 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Database	References
5HT7R	P34969	GNAI3	P08754	Yes	Yes	SIGNOR	SIGNOR:31160049
5HT7R	P34969	GNAO	P09471	Yes	Yes	SIGNOR	SIGNOR:31160049
5HT7R	P34969	GNAL	P38405	Yes	Yes	WangSIGNOR	SIGNOR:31160049
5HT7R	P34969	GNAI1	P63096	Yes	Yes	SIGNOR	SIGNOR:31160049
5HT7R	P34969	GNAS3	O95467	Yes	Yes	WangHINTSIGNOR	SIGNOR:31160049 HINT:35714614
5HT7R	P34969	ALEX	P84996	Yes	Yes	WangHINTSIGNOR	SIGNOR:31160049 HINT:35714614
5HT7R	P34969	GNAS2	P63092	Yes	Yes	WangHINTSIGNOR	SIGNOR:31160049 HINT:35714614
5HT7R	P34969	GNAS1	Q5JWF2	Yes	Yes	WangHINTSIGNOR	SIGNOR:31160049 HINT:35714614
5HT7R	P34969	GNAQ	P50148	Yes	Yes	SIGNOR	SIGNOR:31160049
5HT7R	P34969	GNAZ	P19086	Yes	Yes	SIGNOR	SIGNOR:31160049

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	20570673 36359760

Sequence, Structure & Domains

Sequences

Length

479

Mass

53,555

Sequence

MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD

Alternative Products

Event=Alternative splicing; Named isoforms=3; Comment=Isoform A and isoform B appear to be expressed at higher levels.; Name=D; IsoId=P34969-1; Sequence=Displayed; Name=A; IsoId=P34969-2; Sequence=VSP_001857; Name=B; IsoId=P34969-3; Sequence=VSP_001856

Alternative Sequence

433..479; RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD -> QNADYCRKKGHDS (in isoform A); 433..479; Missing (in isoform B)

3D Structural Models

Turn

142..145; 187..189; 385..387

Helix

84..108; 110..112; 115..133; 135..141; 151..185; 190..193; 196..212; 215..218; 237..247; 249..272; 325..349; 363..384; 389..394; 395..397; 398..401

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Domain (CC)

Specificity for G(s) G alpha proteins is determined by the length of transmembrane regions 5 and 6 (TM5 and TM6).

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance

Disease Involvement

FDA approved drug targets

Related Diseases (9)

Alzheimer disease Attention deficit hyperactivity disorder Bipolar disorder Depression Mental/behavioural/neurodevelopmental disorder Mild neurocognitive disorder Parkinsonism Schizophrenia Sleep-wake disorder

Biomarker

Phase 1; Phase 2; Investigative; Terminated

Drug Targets

FDA approved drug targets

Antibody (3)

HPA065367 HPA073617 CAB080587

Supporting Publications2

PMID	Title	Related sentences
31382537	An Insight into the Proteome of Uveal Melanoma-Derived Ectosomes Reveals the Presence of Potentially Useful Biomarkers.	No related sentences available
38716512	Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics.	No related sentences available