Protein detail

MERL

Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)

Entry name MERL	UniProt ID P35240	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)

Protein Class (5)

Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

Protein Function (6)

Human disease related genes:Cancers:Cancers of the lung and pleura
Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
Predicted intracellular proteins
Cancer-related genes
Disease related genes
Human disease related genes:Congenital malformations:Other congenital malformations

Ensembl

ENSG00000186575

Entrez Gene Symbol

NF2

Gene Synonym (5)

ACNBANFmerlinmerlin-1SCH

Gene Description

NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor

Chromosome

Position

29603556-29698598

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization6

Cell SpecificEpicardial cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cellsSecretome LocationSecreted to bloodSecretome FunctionReceptor

Function & Pathway7

Protein Function (6)

Human disease related genes:Cancers:Cancers of the lung and pleura
Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
Predicted intracellular proteins
Cancer-related genes
Disease related genes
Human disease related genes:Congenital malformations:Other congenital malformations

Cellular Component (19)

Page 1 of 2

Molecular Function (3)

Biological Process (3)

KEGG (4)

Reactome (5)

Mediation Categories (4)

Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence269

Enzyme-Mediated Modification (26)

26 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NF2	PRKACA	P17612	S	10	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:18071304 KEA:18071304 ProtMapper:18071304
NF2	PRKACA	P17612	S	518	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17998937 KEA:15378014 SIGNOR:18071304 ProtMapper:18071304
NF2	NEDD4L	Q96PU5	K	396	ubiquitination	SIGNOR	SIGNOR:33058421
NF2	AKT1	P31749	S	315	phosphorylation	RLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:17891137
NF2	AKT1	P31749	T	230	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
NF2	AKT1	P31749	S	518	phosphorylation	PhosphoSite
NF2	AKT1	P31749	S	10	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
NF2	AKT2	P31751	S	10	phosphorylation	PhosphoSite
NF2	AKT3	Q9Y243	S	10	phosphorylation	PhosphoSite
NF2	PRKX	P51817	S	518	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 2 of 3Previous Next

Ligand-Receptor Signaling (13)

13 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
ferm_domain	intracellular_intercellular_related	HGNC	Yes	No	No	No	No
adhesion_cytoskeleton_adaptor	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network (13)

13 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MERL	P35240	STK3	Q13188	Yes	Yes	No	SIGNOR	SIGNOR:27402866
DCAF1	Q9Y4B6	MERL	P35240	Yes	No	Yes	HPRDHINTLit-BM-17SIGNOR	Lit-BM-17:21750658 Lit-BM-17:24912773 SIGNOR:18332868 Lit-BM-17:18332868 HINT:24912773 HINT:18332868 Lit-BM-17:26549023 HINT:21750658 HPRD:18332868 Lit-BM-17:20178741
TNIK	Q9UKE5	MERL	P35240	Yes	Yes	No	REACH_ProtMapperSIGNORProtMapper	SIGNOR:33495197 ProtMapper:33495197
MERL	P35240	LATS1	O95835	Yes	Yes	No	HINTLit-BM-17SIGNOR	HINT:34337379 Lit-BM-17:26045165 HINT:24012335 HINT:26045165 Lit-BM-17:24012335 SIGNOR:24012335
	COMPLEX:P62877_Q13619_Q16531_Q96SW2	MERL	P35240	Yes	No	Yes	SIGNOR	SIGNOR:18332868
MERL	P35240	STK4	Q13043	Yes	Yes	No	SIGNOR	SIGNOR:27402866
PP1B	P62140	MERL	P35240	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:18071304 ProtMapper:18071304
KAPCA	P17612	MERL	P35240	Yes	Yes	Yes	WangphosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPiPTMnetSIGNORProtMapperKEAKinexus_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper	KEA:15378014 ProtMapper:17998937 KEA:18071304 ProtMapper:18071304 SIGNOR:18071304
PAK1	Q13153	MERL	P35240	Yes	Yes	Yes	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEAdbPTMInnateDBHPRDKinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperSparser_ProtMapperAdhesomeHPRD-phos	Adhesome:14580336 HPRD-phos:18669648 HPRD-phos:19691289 ProtMapper:27285107 ProtMapper:25893302 ProtMapper:18071304 SIGNOR:18071304 ProtMapper:19165420 HINT:11719502 ProtMapper:23162742 ProtMapper:28090172 KEA:17081983 HPRD-phos:20068231 ProtMapper:20302846 KEA:11782491 dbPTM:18669648 KEA:14981079 KEA:15378014 HPRD:14580336 ProtMapper:22567403 HINT:14580336 dbPTM:17081983 ProtMapper:31652973 HPRD-phos:11719502 ProtMapper:19651622 KEA:11719502 ProtMapper:27345717 ProtMapper:18835652 ProtMapper:11719502 ProtMapper:19691289 ProtMapper:26555075 ProtMapper:22105362 InnateDB:11719502 HPRD:11719502 HINT:21481793 Adhesome:21481793 ProtMapper:19036346 Adhesome:11719502 ProtMapper:20068231 ProtMapper:18669648 HPRD-phos:19651622
NED4L	Q96PU5	MERL	P35240	Yes	Yes	No	SIGNOR	SIGNOR:33058421

Page 1 of 2Next

Protein Complex Composition (216)

216 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
BRCA1 CIT JUN NCOA3 PIAS1 PIAS2 PIAS4 RNF212 SUMO1 SUMO2 SUMO3 UBE2I	O14578 O75925 O75928 P05412 P38398 P55854 P61956 P63165 P63279 Q495C1 Q8N2W9 Q9Y6Q9	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6561
ASH2L CXXC1 DPY30 FKBP9 H3C11 H3C15 H4C4 KMT2A KMT2B RBBP5 RNF20 SETD1A SETD1B WDR5 WDR82	O15047 O95302 P61964 P62805 P68431 Q03164 Q15291 Q5VTR2 Q6UXN9 Q71DI3 Q9C005 Q9P0U4 Q9UBL3 Q9UMN6 Q9UPS6	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4204
BLM BRCA1 MRE11 MSH4 MSH5 RAD51 RNF212 RPA1 SUMO2 SUMO3 UBE2I WRN	O15457 O43196 P27694 P38398 P49959 P54132 P55854 P61956 P63279 Q06609 Q14191 Q495C1	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6199
H2AC15 H2BC11 H3C11 H4C4 RNF20 RNF40	O75150 P06899 P0C0S8 P62805 P68431 Q5VTR2	1:2:2:2:2:1	PDB	PDB:8gujPDB:8gui
IL36A RNF20 RNF40 WAC	O75150 Q5VTR2 Q9BTA9 Q9UHA7	0:0:0:0	hu.MAP2
CLUH DCAF4L2 KCNC1 KCNC3 KCNC4 RNF215	O75153 P48547 Q03721 Q14003 Q8NA75 Q9Y6U7	0:0:0:0:0:0	hu.MAP2
GCN1 INF2 NDUFA5 PDCD6	O75340 Q16718 Q27J81 Q92616	0:0:0:0	Havugimana2012	Havugimana2012:C_174
BLM BRCA1 MRE11 PIAS1 PIAS2 PIAS4 RAD51 RNF212 SUMO1 SUMO2 SUMO3 UBE2I	O75925 O75928 P38398 P49959 P54132 P55854 P61956 P63165 P63279 Q06609 Q495C1 Q8N2W9	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8369
DNAJB5 KCNC1 KCNC3 KCNC4 RNF215	O75953 P48547 Q03721 Q14003 Q9Y6U7	0:0:0:0:0	hu.MAP2
BCOR BCORL1 BMI1 CBX7 FBRS KDM2B MORC4 PCGF1 PCGF2 PCGF3 PCGF5 PCGF6 RING1 RNF2 RYBP YAF2	O95931 P35226 P35227 Q06587 Q3KNV8 Q5H9F3 Q6W2J9 Q86SE9 Q8IY57 Q8N488 Q8NHM5 Q8TE76 Q99496 Q9BSM1 Q9BYE7 Q9HAH7	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2

Page 16 of 22Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	40326690

Sequence, Structure & Domains10

Sequences

Length

595

Mass

69,690

Sequence

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

Alternative Products

Event=Alternative splicing; Named isoforms=10; Name=1; Synonyms=I; IsoId=P35240-1; Sequence=Displayed; Name=2; IsoId=P35240-2; Sequence=VSP_000492; Name=3; Synonyms=II; IsoId=P35240-3; Sequence=VSP_007050, VSP_007051; Name=4; Synonyms=delE2/3; IsoId=P35240-4; Sequence=VSP_007041, VSP_007050, VSP_007051; Name=5; Synonyms=delE3; IsoId=P35240-5; Sequence=VSP_007042, VSP_007050, VSP_007051; Name=6; Synonyms=delE2; IsoId=P35240-6; Sequence=VSP_007040, VSP_007050, VSP_007051; Name=7; Synonyms=MER150; IsoId=P35240-7; Sequence=VSP_007045, VSP_007046; Name=8; IsoId=P35240-8; Sequence=VSP_007048, VSP_007050, VSP_007051; Name=9; Synonyms=MER162; IsoId=P35240-9; Sequence=VSP_007044; Name=10; Synonyms=MER151; IsoId=P35240-10; Sequence=VSP_007041, VSP_007043, VSP_007047, VSP_007049

Alternative Sequence

39..121; Missing (in isoform 4 and isoform 10); 39..80; Missing (in isoform 6); 81..121; Missing (in isoform 5); 150..579; Missing (in isoform 9); 150..225; Missing (in isoform 10); 259; N -> R (in isoform 7); 260..595; Missing (in isoform 7); 334..379; MERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEE -> GQRGRSAEAGPAGSTRGGAKSQAEAPGDCHQAHVPAHEPNSSTVAS (in isoform 10); 335..363; Missing (in isoform 8); 380..595; Missing (in isoform 10); 580..595; LTLQSAKSRVAFFEEL -> SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA (in isoform 2); 580..590; LTLQSAKSRVA -> PQAQGRRPICI (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8); 591..595; Missing (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8)

3D Structural Models

Turn

81..83; 155..157; 160..165; 195..197; 215..218

Helix

43..54; 59..61; 105..108; 112..127; 135..150; 171..174; 181..194; 200..211; 258..260; 290..309; 316..336; 513..547; 552..554; 557..562; 573..581; 585..594

Beta Strand

24..27; 32..35; 62..70; 72..74; 77..80; 84..86; 90..100; 220..226; 231..236; 238..244; 249..251; 253..257; 261..267; 270..277; 283..286

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Domain (FT)

22..311; FERM

Clinical Relevance6

Disease Involvement (4)

Cancer-related genesDeafnessDisease variantTumor suppressor

Drugs (13)

SELUMETINIB IMATINIB EVEROLIMUS CETUXIMAB AR-42 NULL CISPLATIN LAPATINIB TEMSIROLIMUS BEVACIZUMAB-AWWB ERLOTINIB CARBOPLATIN OCTREOTIDE ACETATE

Antibody (2)

HPA003097 CAB005385

Interaction Protein (5)

ENSG00000004487ENSG00000118579ENSG00000126016ENSG00000131023ENSG00000185359

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
37432984	Endoglin, a Novel Biomarker and Therapeutical Target to Prevent Malignant Peripheral Nerve Sheath Tumor Growth and Metastasis.	ENG expression was found to be upregulated in both human MPNST tumor tissues and plasma-circulating small extracellular vesicles.