Protein detail

MERL

Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)

Entry name MERL	UniProt ID P35240	EVMP score 0.50
Frequency 1	Transmembrane count	Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)

Protein Class

Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

Protein Function

Human disease related genes:Cancers:Cancers of the lung and pleura
Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
Predicted intracellular proteins
Cancer-related genes
Disease related genes
Human disease related genes:Congenital malformations:Other congenital malformations

Ensembl

ENSG00000186575

Entrez Gene Symbol

NF2

Gene Synonym

ACNBANFmerlinmerlin-1SCH

Gene Description

NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor

Chromosome

Position

29603556-29698598

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificEpicardial cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cellsSecretome LocationSecreted to bloodSecretome FunctionReceptor

Function & Pathway

Protein Function

Human disease related genes:Cancers:Cancers of the lung and pleura
Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
Predicted intracellular proteins
Cancer-related genes
Disease related genes
Human disease related genes:Congenital malformations:Other congenital malformations

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

26 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NF2	PRKY	O43930	S	518	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
NF2	ERBB3	P21860	S	518	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:25893302
NF2	CDKN1A	P38936	S	518	phosphorylation	REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:26549232 ProtMapper:18361411 ProtMapper:11782491 ProtMapper:22750751 ProtMapper:15378014 ProtMapper:17175165
NF2	RAC1	P63000	S	518	phosphorylation	REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:27958595 ProtMapper:23267122 ProtMapper:22567403 ProtMapper:18361411
NF2	ERBB2	P04626	S	518	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:25893302
NF2	NRG1	Q02297	S	518	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:25893302

Page 3 of 3Previous

Ligand-Receptor Signaling

13 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
ferm_domain	intracellular_intercellular_related	HGNC	Yes	No	No	No	No
adhesion_cytoskeleton_adaptor	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network

13 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MERL	P35240	STK3	Q13188	Yes	Yes	No	SIGNOR	SIGNOR:27402866
DCAF1	Q9Y4B6	MERL	P35240	Yes	No	Yes	HPRDHINTLit-BM-17SIGNOR	Lit-BM-17:21750658 Lit-BM-17:24912773 SIGNOR:18332868 Lit-BM-17:18332868 HINT:24912773 HINT:18332868 Lit-BM-17:26549023 HINT:21750658 HPRD:18332868 Lit-BM-17:20178741
TNIK	Q9UKE5	MERL	P35240	Yes	Yes	No	REACH_ProtMapperSIGNORProtMapper	SIGNOR:33495197 ProtMapper:33495197
MERL	P35240	LATS1	O95835	Yes	Yes	No	HINTLit-BM-17SIGNOR	HINT:34337379 Lit-BM-17:26045165 HINT:24012335 HINT:26045165 Lit-BM-17:24012335 SIGNOR:24012335
	COMPLEX:P62877_Q13619_Q16531_Q96SW2	MERL	P35240	Yes	No	Yes	SIGNOR	SIGNOR:18332868
MERL	P35240	STK4	Q13043	Yes	Yes	No	SIGNOR	SIGNOR:27402866
PP1B	P62140	MERL	P35240	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:18071304 ProtMapper:18071304
KAPCA	P17612	MERL	P35240	Yes	Yes	Yes	WangphosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPiPTMnetSIGNORProtMapperKEAKinexus_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper	KEA:15378014 ProtMapper:17998937 KEA:18071304 ProtMapper:18071304 SIGNOR:18071304
PAK1	Q13153	MERL	P35240	Yes	Yes	Yes	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEAdbPTMInnateDBHPRDKinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperSparser_ProtMapperAdhesomeHPRD-phos	Adhesome:14580336 HPRD-phos:18669648 HPRD-phos:19691289 ProtMapper:27285107 ProtMapper:25893302 ProtMapper:18071304 SIGNOR:18071304 ProtMapper:19165420 HINT:11719502 ProtMapper:23162742 ProtMapper:28090172 KEA:17081983 HPRD-phos:20068231 ProtMapper:20302846 KEA:11782491 dbPTM:18669648 KEA:14981079 KEA:15378014 HPRD:14580336 ProtMapper:22567403 HINT:14580336 dbPTM:17081983 ProtMapper:31652973 HPRD-phos:11719502 ProtMapper:19651622 KEA:11719502 ProtMapper:27345717 ProtMapper:18835652 ProtMapper:11719502 ProtMapper:19691289 ProtMapper:26555075 ProtMapper:22105362 InnateDB:11719502 HPRD:11719502 HINT:21481793 Adhesome:21481793 ProtMapper:19036346 Adhesome:11719502 ProtMapper:20068231 ProtMapper:18669648 HPRD-phos:19651622
NED4L	Q96PU5	MERL	P35240	Yes	Yes	No	SIGNOR	SIGNOR:33058421

Page 1 of 2Next

Protein Complex Composition

216 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
PRC1 complex	BMI1 CBX2 CBX4 CBX7 CBX8 PCGF2 PCGF6 PHC1 PHC2 PHC3 RING1 RNF2	O00257 O95931 P35226 P35227 P78364 Q06587 Q14781 Q8IXK0 Q8NDX5 Q99496 Q9BYE7 Q9HC52	1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC1814	19636380 12167701
PRC1L4	CBX3 E2F6 ERH HSPA4 L3MBTL2 PCGF6 PRMT5 RING1 RNF2	O14744 O75461 P34932 P84090 Q06587 Q13185 Q969R5 Q99496 Q9BYE7	1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2564	21596310
PcG protein complex	BCOR BMI1 CBX2 CBX4 CBX6 CBX7 CBX8 CSNK2A1 CSNK2A2 CSNK2B KDM2B PCGF1 PCGF2 PCGF3 PCGF5 PCGF6 PHC1 PHC2 PHC3 RING1 RNF2 RYBP SCML2 SKP1 YY1	O00257 O95503 O95931 P19784 P25490 P35226 P35227 P63208 P67870 P68400 P78364 Q06587 Q14781 Q3KNV8 Q6W2J9 Q86SE9 Q8IXK0 Q8N488 Q8NDX5 Q8NHM5 Q99496 Q9BSM1 Q9BYE7 Q9HC52 Q9UQR0	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC3594	16943429 8521824
Polycomb repressive complex 1	BMI1 CBX2 PCGF2 PHC1 PHC2 RNF2	P35226 P35227 P78364 Q14781 Q8IXK0 Q99496	0:0:0:0:0:0	SIGNOR	SIGNOR:SIGNOR-C408
Polycomb repressive complex 1 (PRC1hPRC-H)	BMI1 CBX2 CBX4 CBX8 HSPA1A PHC1 PHC2 PHC3 RING1 RNF2 SCMH1 SMARCA5 YY1	O00257 O60264 P0DMV8 P25490 P35226 P78364 Q06587 Q14781 Q8IXK0 Q8NDX5 Q96GD3 Q99496 Q9HC52	0:0:0:0:0:0:0:0:0:0:0:0:0	CORUM	CORUM:116	12167701
Polycomb repressive complex 1 (PRC1hPRC-H)	BMI1 CBX2 CBX4 CBX8 HSPA1A PHC1 PHC2 PHC3 RING1 RNF2 SCMH1 SMARCA5	O00257 O60264 P0DMV8 P35226 P78364 Q06587 Q14781 Q8IXK0 Q8NDX5 Q96GD3 Q99496 Q9HC52	0:0:0:0:0:0:0:0:0:0:0:0	CORUM	CORUM:115	12167701
Polycomb repressive complex 1 (PRC1hPRC-H)	BMI1 CBX2 CBX4 CBX8 HSPA1B PHC1 PHC2 PHC3 RING1 RNF2 SCMH1 SMARCA5 YY1	O00257 O60264 P0DMV9 P25490 P35226 P78364 Q06587 Q14781 Q8IXK0 Q8NDX5 Q96GD3 Q99496 Q9HC52	1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC639	12167701
Polycomb repressive complex 1 (PRC1hPRC-H)	BMI1 CBX2 CBX4 CBX8 HSPA1B PHC1 PHC2 PHC3 RING1 RNF2 SCMH1 SMARCA5	O00257 O60264 P0DMV9 P35226 P78364 Q06587 Q14781 Q8IXK0 Q8NDX5 Q96GD3 Q99496 Q9HC52	1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2118	12167701
Polycomb repressive complex 1RING2-PCGF2-CBX2-PHC1 variant	CBX2 PCGF2 PHC1 RNF2	P35227 P78364 Q14781 Q99496	1:1:1:1	ComplexPortal	intact:EBI-34603851	22325352 34009336 28087428 14755292 34680880
Polycomb repressive complex 1RING2-PCGF2-CBX2-PHC2 variant	CBX2 PCGF2 PHC2 RNF2	P35227 Q14781 Q8IXK0 Q99496	1:1:1:1	ComplexPortal	intact:EBI-34603892	22325352 34009336 28087428 14755292 34680880

Page 3 of 22Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	40326690

Sequence, Structure & Domains

Sequences

Length

595

Mass

69,690

Sequence

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

Alternative Products

Event=Alternative splicing; Named isoforms=10; Name=1; Synonyms=I; IsoId=P35240-1; Sequence=Displayed; Name=2; IsoId=P35240-2; Sequence=VSP_000492; Name=3; Synonyms=II; IsoId=P35240-3; Sequence=VSP_007050, VSP_007051; Name=4; Synonyms=delE2/3; IsoId=P35240-4; Sequence=VSP_007041, VSP_007050, VSP_007051; Name=5; Synonyms=delE3; IsoId=P35240-5; Sequence=VSP_007042, VSP_007050, VSP_007051; Name=6; Synonyms=delE2; IsoId=P35240-6; Sequence=VSP_007040, VSP_007050, VSP_007051; Name=7; Synonyms=MER150; IsoId=P35240-7; Sequence=VSP_007045, VSP_007046; Name=8; IsoId=P35240-8; Sequence=VSP_007048, VSP_007050, VSP_007051; Name=9; Synonyms=MER162; IsoId=P35240-9; Sequence=VSP_007044; Name=10; Synonyms=MER151; IsoId=P35240-10; Sequence=VSP_007041, VSP_007043, VSP_007047, VSP_007049

Alternative Sequence

39..121; Missing (in isoform 4 and isoform 10); 39..80; Missing (in isoform 6); 81..121; Missing (in isoform 5); 150..579; Missing (in isoform 9); 150..225; Missing (in isoform 10); 259; N -> R (in isoform 7); 260..595; Missing (in isoform 7); 334..379; MERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEE -> GQRGRSAEAGPAGSTRGGAKSQAEAPGDCHQAHVPAHEPNSSTVAS (in isoform 10); 335..363; Missing (in isoform 8); 380..595; Missing (in isoform 10); 580..595; LTLQSAKSRVAFFEEL -> SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA (in isoform 2); 580..590; LTLQSAKSRVA -> PQAQGRRPICI (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8); 591..595; Missing (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8)

3D Structural Models

Turn

81..83; 155..157; 160..165; 195..197; 215..218

Helix

43..54; 59..61; 105..108; 112..127; 135..150; 171..174; 181..194; 200..211; 258..260; 290..309; 316..336; 513..547; 552..554; 557..562; 573..581; 585..594

Beta Strand

24..27; 32..35; 62..70; 72..74; 77..80; 84..86; 90..100; 220..226; 231..236; 238..244; 249..251; 253..257; 261..267; 270..277; 283..286

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Domain (FT)

22..311; FERM

Clinical Relevance

Disease Involvement

Cancer-related genesDeafnessDisease variantTumor suppressor

Drugs

SELUMETINIB IMATINIB EVEROLIMUS CETUXIMAB AR-42 NULL CISPLATIN LAPATINIB TEMSIROLIMUS BEVACIZUMAB-AWWB ERLOTINIB CARBOPLATIN OCTREOTIDE ACETATE

Antibody

HPA003097 CAB005385

Interaction Protein

ENSG00000004487ENSG00000118579ENSG00000126016ENSG00000131023ENSG00000185359

Interaction Count

Interaction Dataset

intact_biogrid