Protein detail
MERL
Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)
Entry name MERL | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (6)
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Cancer-related genes
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
ACNBANFmerlinmerlin-1SCH
Gene Description
NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor
Chromosome
22
Position
29603556-29698598
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificEpicardial cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cellsSecretome LocationSecreted to bloodSecretome FunctionReceptor
Function & Pathway
Protein Function (6)
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Cancer-related genes
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (19)
- GO:0005634 nucleus
- GO:0005730 nucleolus
- GO:0005737 cytoplasm
- GO:0005769 early endosome
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0016020 membrane
- GO:0030027 lamellipodium
Page 1 of 2
Molecular Function (3)
Biological Process (3)
KEGG (4)
Reactome (5)
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence269
Enzyme-Mediated Modification (26)
26 records.
Page 1 of 3Next
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_phobius | transmembrane_predicted | Almen2009 | |||||
| transmembrane_sosui | transmembrane_predicted | Almen2009 | |||||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 |
Page 2 of 2Previous
Regulatory Interaction Network (13)
13 records.
Page 2 of 2Previous
Protein Complex Composition (216)
216 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Ub:RING_E3 | RNF223UBB | E7ERA6P0CG47 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF223UBC | E7ERA6P0CG48 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF223RPS27A | E7ERA6P62979 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF223UBA52 | E7ERA6P62987 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF225UBB | M0QZC1P0CG47 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF225UBC | M0QZC1P0CG48 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF225RPS27A | M0QZC1P62979 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF225UBA52 | M0QZC1P62987 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF224UBB | P0CG47P0DH78 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RNF212UBB | P0CG47Q495C1 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 40326690 |
Sequence, Structure & Domains
Sequences
Length
595
Mass
69,690
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
Alternative Products
Event=Alternative splicing; Named isoforms=10; Name=1; Synonyms=I; IsoId=P35240-1; Sequence=Displayed; Name=2; IsoId=P35240-2; Sequence=VSP_000492; Name=3; Synonyms=II; IsoId=P35240-3; Sequence=VSP_007050, VSP_007051; Name=4; Synonyms=delE2/3; IsoId=P35240-4; Sequence=VSP_007041, VSP_007050, VSP_007051; Name=5; Synonyms=delE3; IsoId=P35240-5; Sequence=VSP_007042, VSP_007050, VSP_007051; Name=6; Synonyms=delE2; IsoId=P35240-6; Sequence=VSP_007040, VSP_007050, VSP_007051; Name=7; Synonyms=MER150; IsoId=P35240-7; Sequence=VSP_007045, VSP_007046; Name=8; IsoId=P35240-8; Sequence=VSP_007048, VSP_007050, VSP_007051; Name=9; Synonyms=MER162; IsoId=P35240-9; Sequence=VSP_007044; Name=10; Synonyms=MER151; IsoId=P35240-10; Sequence=VSP_007041, VSP_007043, VSP_007047, VSP_007049
Alternative Sequence
39..121; Missing (in isoform 4 and isoform 10); 39..80; Missing (in isoform 6); 81..121; Missing (in isoform 5); 150..579; Missing (in isoform 9); 150..225; Missing (in isoform 10); 259; N -> R (in isoform 7); 260..595; Missing (in isoform 7); 334..379; MERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEE -> GQRGRSAEAGPAGSTRGGAKSQAEAPGDCHQAHVPAHEPNSSTVAS (in isoform 10); 335..363; Missing (in isoform 8); 380..595; Missing (in isoform 10); 580..595; LTLQSAKSRVAFFEEL -> SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA (in isoform 2); 580..590; LTLQSAKSRVA -> PQAQGRRPICI (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8); 591..595; Missing (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8)
3D Structural Models
Turn
81..83; 155..157; 160..165; 195..197; 215..218
Helix
43..54; 59..61; 105..108; 112..127; 135..150; 171..174; 181..194; 200..211; 258..260; 290..309; 316..336; 513..547; 552..554; 557..562; 573..581; 585..594
Beta Strand
24..27; 32..35; 62..70; 72..74; 77..80; 84..86; 90..100; 220..226; 231..236; 238..244; 249..251; 253..257; 261..267; 270..277; 283..286
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Domain (FT)
22..311; FERM
Clinical Relevance
Disease Involvement (4)
Cancer-related genesDeafnessDisease variantTumor suppressor
Related Diseases
Drugs (13)
Interaction Protein (5)
ENSG00000004487ENSG00000118579ENSG00000126016ENSG00000131023ENSG00000185359
Interaction Count
5
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37432984 | Endoglin, a Novel Biomarker and Therapeutical Target to Prevent Malignant Peripheral Nerve Sheath Tumor Growth and Metastasis. | ENG expression was found to be upregulated in both human MPNST tumor tissues and plasma-circulating small extracellular vesicles. |