Protein detail

MERL

Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)

Entry name MERL	UniProt ID P35240	EVMP score 0.50
Frequency 1	Transmembrane count	Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)

Protein Class

Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

Protein Function

Human disease related genes:Cancers:Cancers of the lung and pleura
Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
Predicted intracellular proteins
Cancer-related genes
Disease related genes
Human disease related genes:Congenital malformations:Other congenital malformations

Ensembl

ENSG00000186575

Entrez Gene Symbol

NF2

Gene Synonym

ACNBANFmerlinmerlin-1SCH

Gene Description

NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor

Chromosome

Position

29603556-29698598

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificEpicardial cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cellsSecretome LocationSecreted to bloodSecretome FunctionReceptor

Function & Pathway

Protein Function

Human disease related genes:Cancers:Cancers of the lung and pleura
Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
Predicted intracellular proteins
Cancer-related genes
Disease related genes
Human disease related genes:Congenital malformations:Other congenital malformations

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

26 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NF2	PRKACA	P17612	S	10	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:18071304 KEA:18071304 ProtMapper:18071304
NF2	PRKACA	P17612	S	518	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17998937 KEA:15378014 SIGNOR:18071304 ProtMapper:18071304
NF2	NEDD4L	Q96PU5	K	396	ubiquitination	SIGNOR	SIGNOR:33058421
NF2	AKT1	P31749	S	315	phosphorylation	RLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:17891137
NF2	AKT1	P31749	T	230	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
NF2	AKT1	P31749	S	518	phosphorylation	PhosphoSite
NF2	AKT1	P31749	S	10	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
NF2	AKT2	P31751	S	10	phosphorylation	PhosphoSite
NF2	AKT3	Q9Y243	S	10	phosphorylation	PhosphoSite
NF2	PRKX	P51817	S	518	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 2 of 3Previous Next

Ligand-Receptor Signaling

13 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	No	No	No
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	No	No	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	No	No

Page 2 of 2Previous

Regulatory Interaction Network

13 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MERL	P35240	STK3	Q13188	Yes	Yes	No	SIGNOR	SIGNOR:27402866
DCAF1	Q9Y4B6	MERL	P35240	Yes	No	Yes	HPRDHINTLit-BM-17SIGNOR	Lit-BM-17:21750658 Lit-BM-17:24912773 SIGNOR:18332868 Lit-BM-17:18332868 HINT:24912773 HINT:18332868 Lit-BM-17:26549023 HINT:21750658 HPRD:18332868 Lit-BM-17:20178741
TNIK	Q9UKE5	MERL	P35240	Yes	Yes	No	REACH_ProtMapperSIGNORProtMapper	SIGNOR:33495197 ProtMapper:33495197
MERL	P35240	LATS1	O95835	Yes	Yes	No	HINTLit-BM-17SIGNOR	HINT:34337379 Lit-BM-17:26045165 HINT:24012335 HINT:26045165 Lit-BM-17:24012335 SIGNOR:24012335
	COMPLEX:P62877_Q13619_Q16531_Q96SW2	MERL	P35240	Yes	No	Yes	SIGNOR	SIGNOR:18332868
MERL	P35240	STK4	Q13043	Yes	Yes	No	SIGNOR	SIGNOR:27402866
PP1B	P62140	MERL	P35240	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:18071304 ProtMapper:18071304
KAPCA	P17612	MERL	P35240	Yes	Yes	Yes	WangphosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPiPTMnetSIGNORProtMapperKEAKinexus_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper	KEA:15378014 ProtMapper:17998937 KEA:18071304 ProtMapper:18071304 SIGNOR:18071304
PAK1	Q13153	MERL	P35240	Yes	Yes	Yes	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEAdbPTMInnateDBHPRDKinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperSparser_ProtMapperAdhesomeHPRD-phos	Adhesome:14580336 HPRD-phos:18669648 HPRD-phos:19691289 ProtMapper:27285107 ProtMapper:25893302 ProtMapper:18071304 SIGNOR:18071304 ProtMapper:19165420 HINT:11719502 ProtMapper:23162742 ProtMapper:28090172 KEA:17081983 HPRD-phos:20068231 ProtMapper:20302846 KEA:11782491 dbPTM:18669648 KEA:14981079 KEA:15378014 HPRD:14580336 ProtMapper:22567403 HINT:14580336 dbPTM:17081983 ProtMapper:31652973 HPRD-phos:11719502 ProtMapper:19651622 KEA:11719502 ProtMapper:27345717 ProtMapper:18835652 ProtMapper:11719502 ProtMapper:19691289 ProtMapper:26555075 ProtMapper:22105362 InnateDB:11719502 HPRD:11719502 HINT:21481793 Adhesome:21481793 ProtMapper:19036346 Adhesome:11719502 ProtMapper:20068231 ProtMapper:18669648 HPRD-phos:19651622
NED4L	Q96PU5	MERL	P35240	Yes	Yes	No	SIGNOR	SIGNOR:33058421

Page 1 of 2Next

Protein Complex Composition

216 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
BCOR	BCOR HSPA4 KDM2B PCGF1 RING1 RNF2 RYBP SKP1	P34932 P63208 Q06587 Q6W2J9 Q8N488 Q8NHM5 Q99496 Q9BSM1	1:1:1:1:1:1:1:1	Compleat	Compleat:HC368	16943429
BCOR	BCOR KDM2B PCGF1 RING1 RNF2	Q06587 Q6W2J9 Q8NHM5 Q99496 Q9BSM1	0:0:0:0:0	SPIKE
BCOR complex	BCOR HSPA8 KDM2B PCGF1 RING1 RNF2 RYBP SKP1	P11142 P63208 Q06587 Q6W2J9 Q8N488 Q8NHM5 Q99496 Q9BSM1	1:1:1:1:1:1:1:1	CompleatCORUM	Compleat:HC2531CORUM:1178	16943429
BRE1 E3 ubiquitin ligase complex	RNF20 RNF40	O75150 Q5VTR2	1:1	ComplexPortal	intact:EBI-46451439	16307923 14755292 35954248 31152661
E2F-6 complex	E2F6 EHMT1 EHMT2 GJB3 L3MBTL2 MAX MGA PCGF6 RING1 RNF2 TFDP1 YAF2	O75461 O75712 P61244 Q06587 Q14186 Q8IWI9 Q8IY57 Q969R5 Q96KQ7 Q99496 Q9BYE7 Q9H9B1	1:1:1:1:1:1:1:1:1:1:1:1	CompleatCORUM	CORUM:1194Compleat:HC2145	12004135
E2F6.com-1	CBX3 E2F6 EHMT1 EHMT2 L3MBTL1 MAX MGA PCGF6 RING1 RNF2 TFDP1 YAF2	O75461 P61244 Q06587 Q13185 Q14186 Q8IWI9 Q8IY57 Q96KQ7 Q99496 Q9BYE7 Q9H9B1 Q9Y468	1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2004	12004135
Emerin complex 32	ACTB BANF2 CHD4 DPY30 EMD H3C11 HDAC1 HDAC3 LMNB1 MED4 NMI RBL1 RBL2 RCOR1 SAP18 SMARCB1 SMARCC1 SMARCC2 SPTAN1 TBL1XR1 TBL1Y TRIM28	O00422 O15379 P20700 P28749 P50402 P60709 P68431 Q08999 Q12824 Q13263 Q13287 Q13547 Q13813 Q14839 Q8TAQ2 Q92922 Q9BQ87 Q9BZK7 Q9C005 Q9H503 Q9NPJ6 Q9UKL0	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	CompleatCORUM	CORUM:5614Compleat:HC1422	17620012
HT_DM_Cluster554	CBX2 CBX4 CBX6 CBX7 CBX8 RING1 RNF2	O00257 O95503 O95931 Q06587 Q14781 Q99496 Q9HC52	1:1:1:1:1:1:1	Compleat	Compleat:HC2116	22036573
HT_DM_Cluster85	CBX5 IMPA1 IMPA2 RNF212 TXN UBE2V1 UBE2V2	O14732 P10599 P29218 P45973 Q13404 Q15819 Q495C1	1:1:1:1:1:1:1	Compleat	Compleat:HC2098	22036573
ICEN	BMI1 CBLL1 CBX3 CBX8 CENPA CENPB CENPC CENPH CENPI CENPK CENPL CENPM CENPN CENPO CENPT CENPU CUL4A DDB1 DHX38 FBL HDAC1 HSPA5 HSPA8 KIF23 NUP93 PHC2 PHIP RACGAP1 RING1 RNF2 RSF1 SHCBP1 SMARCA5 SRRT SSRP1 SUPT16H VIRMA WTAP ZC3H13 ZFP91	O60264 P07199 P11021 P11142 P22087 P35226 P49450 Q02241 Q03188 Q06587 Q08945 Q13185 Q13547 Q13619 Q15007 Q16531 Q5T200 Q69YN4 Q71F23 Q75N03 Q8IXK0 Q8N0S6 Q8N1F7 Q8NEM2 Q8WWQ0 Q92620 Q92674 Q96BT3 Q96H22 Q96JP5 Q96T23 Q99496 Q9BS16 Q9BU64 Q9BXP5 Q9H0H5 Q9H3R5 Q9HC52 Q9NSP4 Q9Y5B9	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC1100	16716197

Page 1 of 22Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	40326690

Sequence, Structure & Domains

Sequences

Length

595

Mass

69,690

Sequence

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

Alternative Products

Event=Alternative splicing; Named isoforms=10; Name=1; Synonyms=I; IsoId=P35240-1; Sequence=Displayed; Name=2; IsoId=P35240-2; Sequence=VSP_000492; Name=3; Synonyms=II; IsoId=P35240-3; Sequence=VSP_007050, VSP_007051; Name=4; Synonyms=delE2/3; IsoId=P35240-4; Sequence=VSP_007041, VSP_007050, VSP_007051; Name=5; Synonyms=delE3; IsoId=P35240-5; Sequence=VSP_007042, VSP_007050, VSP_007051; Name=6; Synonyms=delE2; IsoId=P35240-6; Sequence=VSP_007040, VSP_007050, VSP_007051; Name=7; Synonyms=MER150; IsoId=P35240-7; Sequence=VSP_007045, VSP_007046; Name=8; IsoId=P35240-8; Sequence=VSP_007048, VSP_007050, VSP_007051; Name=9; Synonyms=MER162; IsoId=P35240-9; Sequence=VSP_007044; Name=10; Synonyms=MER151; IsoId=P35240-10; Sequence=VSP_007041, VSP_007043, VSP_007047, VSP_007049

Alternative Sequence

39..121; Missing (in isoform 4 and isoform 10); 39..80; Missing (in isoform 6); 81..121; Missing (in isoform 5); 150..579; Missing (in isoform 9); 150..225; Missing (in isoform 10); 259; N -> R (in isoform 7); 260..595; Missing (in isoform 7); 334..379; MERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEE -> GQRGRSAEAGPAGSTRGGAKSQAEAPGDCHQAHVPAHEPNSSTVAS (in isoform 10); 335..363; Missing (in isoform 8); 380..595; Missing (in isoform 10); 580..595; LTLQSAKSRVAFFEEL -> SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA (in isoform 2); 580..590; LTLQSAKSRVA -> PQAQGRRPICI (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8); 591..595; Missing (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8)

3D Structural Models

Turn

81..83; 155..157; 160..165; 195..197; 215..218

Helix

43..54; 59..61; 105..108; 112..127; 135..150; 171..174; 181..194; 200..211; 258..260; 290..309; 316..336; 513..547; 552..554; 557..562; 573..581; 585..594

Beta Strand

24..27; 32..35; 62..70; 72..74; 77..80; 84..86; 90..100; 220..226; 231..236; 238..244; 249..251; 253..257; 261..267; 270..277; 283..286

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Domain (FT)

22..311; FERM

Clinical Relevance

Disease Involvement

Cancer-related genesDeafnessDisease variantTumor suppressor

Drugs

SELUMETINIB IMATINIB EVEROLIMUS CETUXIMAB AR-42 NULL CISPLATIN LAPATINIB TEMSIROLIMUS BEVACIZUMAB-AWWB ERLOTINIB CARBOPLATIN OCTREOTIDE ACETATE

Antibody

HPA003097 CAB005385

Interaction Protein

ENSG00000004487ENSG00000118579ENSG00000126016ENSG00000131023ENSG00000185359

Interaction Count

Interaction Dataset

intact_biogrid