Protein detail
MERL
Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)
Entry name MERL | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)
Protein Class
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Cancer-related genes
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Ensembl
Entrez Gene Symbol
Gene Synonym
ACNBANFmerlinmerlin-1SCH
Gene Description
NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor
Chromosome
22
Position
29603556-29698598
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificEpicardial cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cellsSecretome LocationSecreted to bloodSecretome FunctionReceptor
Function & Pathway
Protein Function
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Cancer-related genes
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component
- GO:0005634 nucleus
- GO:0005730 nucleolus
- GO:0005737 cytoplasm
- GO:0005769 early endosome
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0016020 membrane
- GO:0030027 lamellipodium
- GO:0030175 filopodium
- GO:0030864 cortical actin cytoskeleton
- GO:0031527 filopodium membrane
- GO:0032154 cleavage furrow
- GO:0032587 ruffle membrane
- GO:0043005 neuron projection
- GO:0044297 cell body
- GO:0045177 apical part of cell
- GO:0048471 perinuclear region of cytoplasm
Biological Process
KEGG
Reactome
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
26 records.
Page 1 of 3Next
Ligand-Receptor Signaling
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | No | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | No | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | No | No |
Page 2 of 2Previous
Regulatory Interaction Network
13 records.
Page 2 of 2Previous
Protein Complex Composition
216 records.
Page 1 of 22Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 40326690 |
Sequence, Structure & Domains
Sequences
Length
595
Mass
69,690
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
Alternative Products
Event=Alternative splicing; Named isoforms=10; Name=1; Synonyms=I; IsoId=P35240-1; Sequence=Displayed; Name=2; IsoId=P35240-2; Sequence=VSP_000492; Name=3; Synonyms=II; IsoId=P35240-3; Sequence=VSP_007050, VSP_007051; Name=4; Synonyms=delE2/3; IsoId=P35240-4; Sequence=VSP_007041, VSP_007050, VSP_007051; Name=5; Synonyms=delE3; IsoId=P35240-5; Sequence=VSP_007042, VSP_007050, VSP_007051; Name=6; Synonyms=delE2; IsoId=P35240-6; Sequence=VSP_007040, VSP_007050, VSP_007051; Name=7; Synonyms=MER150; IsoId=P35240-7; Sequence=VSP_007045, VSP_007046; Name=8; IsoId=P35240-8; Sequence=VSP_007048, VSP_007050, VSP_007051; Name=9; Synonyms=MER162; IsoId=P35240-9; Sequence=VSP_007044; Name=10; Synonyms=MER151; IsoId=P35240-10; Sequence=VSP_007041, VSP_007043, VSP_007047, VSP_007049
Alternative Sequence
39..121; Missing (in isoform 4 and isoform 10); 39..80; Missing (in isoform 6); 81..121; Missing (in isoform 5); 150..579; Missing (in isoform 9); 150..225; Missing (in isoform 10); 259; N -> R (in isoform 7); 260..595; Missing (in isoform 7); 334..379; MERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEE -> GQRGRSAEAGPAGSTRGGAKSQAEAPGDCHQAHVPAHEPNSSTVAS (in isoform 10); 335..363; Missing (in isoform 8); 380..595; Missing (in isoform 10); 580..595; LTLQSAKSRVAFFEEL -> SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA (in isoform 2); 580..590; LTLQSAKSRVA -> PQAQGRRPICI (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8); 591..595; Missing (in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8)
3D Structural Models
Turn
81..83; 155..157; 160..165; 195..197; 215..218
Helix
43..54; 59..61; 105..108; 112..127; 135..150; 171..174; 181..194; 200..211; 258..260; 290..309; 316..336; 513..547; 552..554; 557..562; 573..581; 585..594
Beta Strand
24..27; 32..35; 62..70; 72..74; 77..80; 84..86; 90..100; 220..226; 231..236; 238..244; 249..251; 253..257; 261..267; 270..277; 283..286
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Domain (FT)
22..311; FERM
Clinical Relevance
Disease Involvement
Cancer-related genesDeafnessDisease variantTumor suppressor
Drugs
Interaction Protein
ENSG00000004487ENSG00000118579ENSG00000126016ENSG00000131023ENSG00000185359
Interaction Count
5
Interaction Dataset
intact_biogrid