Protein detail
SSR5
Somatostatin receptor type 5 (SS-5-R) (SS5-R) (SS5R) (SST5)
Entry name SSR5 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Somatostatin receptor type 5 (SS-5-R) (SS5-R) (SS5R) (SST5)
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
39..66; Helical; Name=1; 77..101; Helical; Name=2; 114..135; Helical; Name=3; 158..178; Helical; Name=4; 198..222; Helical; Name=5; 248..273; Helical; Name=6; 284..308; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Tissue Specificfallopian tubeCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell Specificplasmacytoid DC
Function & Pathway8
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
KEGG (4)
Reactome (5)
Canonical Pathways
M83 Pid cdc42 reg pathway
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence61
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SSTR5 | GRK2 | P25098 | T | 333 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (55)
55 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr | receptor | Almen2009 | No | Yes | No | Yes | No |
| rhodopsin | receptor | Almen2009 | No | Yes | No | Yes | No |
| gpcr | receptor | UniProt_keyword | No | Yes | No | Yes | No |
| seven_transmembrane_7tm | receptor | HPMR | No | Yes | No | Yes | No |
| 7tm_a | receptor | HPMR | No | Yes | No | Yes | No |
| somatostatin_oprl_npw_7tm_a | receptor | HPMR | No | Yes | No | Yes | No |
| rhodopsin | receptor | Surfaceome | No | Yes | No | Yes | No |
| gpcr | receptor | Surfaceome | No | Yes | No | Yes | No |
| class_a_rhodopsin | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_peptide | receptor | GPCRdb | No | Yes | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SSR5 | P35346 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| SSR5 | P35346 | GNAI3 | P08754 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| SSR5 | P35346 | GNAI1 | P63096 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains11
Sequences
Length
364
Mass
39,202
Sequence
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
3D Structural Models
Turn
144..150; 189..191; 279..281; 304..307
Helix
43..66; 74..90; 93..101; 108..142; 153..177; 181..183; 194..209; 211..234; 241..273; 283..303; 309..315
Beta Strand
71..73
3D Structure
Electron microscopy (5)
Domain & Motif Annotations
Compositional Bias
327..342; Basic and acidic residues
Region
1..20; Disordered; 327..364; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance3
Related Diseases (3)
Biomarker
Terminated; Approved; Investigative
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No abstract available |