Protein detail

APJ

Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)

Entry name APJ	UniProt ID P35414	EVMP confidence score 0.25
Supporting publications (n) 2	Transmembrane count 7	Protein classification G-protein coupled receptorsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)

Protein Class (3)

G-protein coupled receptorsPredicted membrane proteinsTransporters

Protein Function (2)

Transporters
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

31..54; Helical; Name=1; 65..86; Helical; Name=2; 100..125; Helical; Name=3; 147..164; Helical; Name=4; 199..223; Helical; Name=5; 247..270; Helical; Name=6; 290..312; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000134817

Entrez Gene Symbol

APLNR

Gene Synonym (4)

AGTRL1APJAPJRFLJ90771

Gene Description

Apelin receptor

Chromosome

Position

57233577-57237250

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway8

Protein Function (2)

Transporters
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component

GO:0005886 plasma membrane

Molecular Function (4)

Biological Process (3)

KEGG (2)

Reactome (5)

Canonical Pathways (3)

M1718 Sig il4receptor in b lyphocytes
M234 Pid il2 stat5 pathway
M45 Pid cd40 pathway

Mediation Categories (5)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence64

Ligand-Receptor Signaling (59)

59 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellChatDB	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	Guide2Pharma	No	Yes	No	Yes	No
gpcr	receptor	DGIdb	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No

Page 1 of 6Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
APJ	P35414	GNA14	O95837	Yes	Yes	No	SIGNOR	SIGNOR:31160049
APJ	P35414	GNAI3	P08754	Yes	Yes	No	SIGNOR	SIGNOR:31160049
APJ	P35414	GNAI1	P63096	Yes	Yes	No	HINTSIGNOR	HINT:38428423 SIGNOR:31160049 HINT:35817871

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	APLNR	P35414	2	PDB	PDB:8xqjPDB:8xqiPDB:8z74

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration	Mass spectrometry	3	38207106 36497184 27487081

Sequence, Structure & Domains12

Sequences

Length

380

Mass

42,660

Sequence

MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD

3D Structural Models

Turn

21..23; 91..93; 134..136; 174..176; 186..188; 229..231; 276..278; 326..329

Helix

13..16; 25..28; 30..55; 58..60; 65..79; 82..90; 98..131; 137..140; 142..160; 162..167; 191..193; 194..209; 211..228; 245..275; 281..312; 314..325

Beta Strand

9..12; 18..20; 168..171; 180..183; 234..236

3D Structure

Electron microscopy (17); NMR spectroscopy (4); X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

342..351; Low complexity; 371..380; Polar residues

Domain (CC)

The hydrogen bond between Asn-46 and Asp-75 is crucial for beta-arrestin signaling induced by APLN/apelin-13..

Region

342..380; Disordered

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance5

Related Diseases

Heart failure

Biomarker

Phase 1

Drug Targets

Clinical trial target

Drugs (2)

APELIN AZELAPRAG

Antibody

CAB025842

Supporting Publications2

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No abstract available