Protein detail
APJ
Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)
Entry name APJ | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)
Protein Class (3)
G-protein coupled receptorsPredicted membrane proteinsTransporters
Protein Function (2)
- Transporters
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
31..54; Helical; Name=1; 65..86; Helical; Name=2; 100..125; Helical; Name=3; 147..164; Helical; Name=4; 199..223; Helical; Name=5; 247..270; Helical; Name=6; 290..312; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
AGTRL1APJAPJRFLJ90771
Gene Description
Apelin receptor
Chromosome
11
Position
57233577-57237250
Supporting publications (n)
2
EVMP confidence score
0.25
Function & Pathway8
Protein Function (2)
- Transporters
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function (4)
Biological Process (3)
Reactome (5)
Canonical Pathways (3)
- M1718 Sig il4receptor in b lyphocytes
- M234 Pid il2 stat5 pathway
- M45 Pid cd40 pathway
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence64
Ligand-Receptor Signaling (59)
59 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| class_a_rhodopsin_peptide | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_peptide_apelin | receptor | GPCRdb | No | Yes | No | Yes | No |
| gpcr | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| APJ | P35414 | GNA14 | O95837 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| APJ | P35414 | GNAI3 | P08754 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| APJ | P35414 | GNAI1 | P63096 | Yes | Yes | No | HINTSIGNOR | HINT:38428423SIGNOR:31160049HINT:35817871 |
Protein Complex Composition (1)
Sequence, Structure & Domains12
Sequences
Length
380
Mass
42,660
Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
3D Structural Models
Turn
21..23; 91..93; 134..136; 174..176; 186..188; 229..231; 276..278; 326..329
Helix
13..16; 25..28; 30..55; 58..60; 65..79; 82..90; 98..131; 137..140; 142..160; 162..167; 191..193; 194..209; 211..228; 245..275; 281..312; 314..325
Beta Strand
9..12; 18..20; 168..171; 180..183; 234..236
3D Structure
Electron microscopy (17); NMR spectroscopy (4); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
342..351; Low complexity; 371..380; Polar residues
Domain (CC)
The hydrogen bond between Asn-46 and Asp-75 is crucial for beta-arrestin signaling induced by APLN/apelin-13..
Region
342..380; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance5
Related Diseases
Biomarker
Phase 1
Drug Targets
Clinical trial target
Antibody
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |