Protein detail

TIE1

Tyrosine-protein kinase receptor Tie-1 (EC 2.7.10.1)

Entry name TIE1	UniProt ID P35590	EVMP confidence score 0.25
Supporting publications (n) 4	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Tyrosine-protein kinase receptor Tie-1 (EC 2.7.10.1)

Protein Function (8)

Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Kinases:Tyr protein kinases
Disease related genes

Transmembrane

760..784; Helical

Transmembrane Count

Ensembl

ENSG00000066056

Entrez Gene Symbol

TIE1

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization2

Tissue SpecificintestineCell SpecificColonocytes

Function & Pathway5

Protein Function (8)

Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Kinases:Tyr protein kinases
Disease related genes

Cellular Component (2)

Molecular Function (3)

Biological Process (3)

Mediation Categories (2)

Fusion and delivery mediationReceptor-signaling mediation

Relations & Evidence59

Ligand-Receptor Signaling (54)

54 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	No	Yes	No
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	No	Yes	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	Yes	No

Page 6 of 6Previous

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ANGP4	Q9Y264	TIE1	P35590	Yes	Yes	No	Fantom5_LRdbCellTalkDBiTALKtalklrSignaLink3LRdbSTRING_talklrEMBRACE	SignaLink3:10051567 CellTalkDB:15851516 SignaLink3:23331499
TIE2	Q02763	TIE1	P35590	Yes	Yes	No	HPRDPhosphoPointSIGNOR	SIGNOR:15851516 HPRD:10995770
ANGP1	Q15389	TIE1	P35590	Yes	Yes	No	HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020Baccin2019Ramilowski2015_Baccin2019CellinkerWangLRdbEMBRACEHPMR_talklr	CellTalkDB:11172728 SIGNOR:11172728 HPMR:11172728 Baccin2019:11172728 Cellinker:11172728 LRdb:11172728 connectomeDB2020:11172728

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	TIE1	P35590	2	PDB	PDB:5n06

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	38716512

Sequence, Structure & Domains10

Sequences

Length

1,138

Mass

125,090

Sequence

MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P35590-1; Sequence=Displayed; Name=2; IsoId=P35590-2; Sequence=VSP_047609, VSP_047610; Name=3; IsoId=P35590-3; Sequence=VSP_047607, VSP_047608

Alternative Sequence

305..317; ACAPGHFGADCRL -> VHQGHCGAREDHS (in isoform 3); 318..1138; Missing (in isoform 3); 348..379; DRIPQILNMASELEFNLETMPRINCAAAGNPF -> GWRDWVDTSTEKQNTDEGRFGGHVSAPVGAPG (in isoform 2); 380..1138; Missing (in isoform 2)

3D Structural Models

Beta Strand

648..656; 659..665; 676..682; 691..695; 701..707; 714..728

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Domain (FT)

43..105; Ig-like C2-type 1; 214..256; EGF-like 1; 258..303; EGF-like 2; 305..345; EGF-like 3; 372..426; Ig-like C2-type 2; 446..545; Fibronectin type-III 1; 548..642; Fibronectin type-III 2; 646..739; Fibronectin type-III 3; 839..1118; Protein kinase

Protein Families (3)

Protein kinase superfamily
Tyr protein kinase family
Tie subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.

Clinical Relevance1

Drugs

CP-459632

Supporting Publications4

PMID	Title	Abstract
34980157	Proteomic analysis of extracellular vesicles secreted by primary human epithelial endometrial cells reveals key proteins related to embryo implantation.	No abstract available
39363010	Proteomic analysis of plasma-derived extracellular vesicles: pre- and postprandial comparisons.	No abstract available
40222457	Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement.	No abstract available
40595564	Enrichment of extracellular vesicles using Mag-Net for the analysis of the plasma proteome.	No abstract available