Protein detail
TIE1
Tyrosine-protein kinase receptor Tie-1 (EC 2.7.10.1)
Entry name TIE1 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Tyrosine-protein kinase receptor Tie-1 (EC 2.7.10.1)
Protein Function (8)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Kinases:Tyr protein kinases
- Disease related genes
Transmembrane
760..784; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway
Protein Function (8)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Kinases:Tyr protein kinases
- Disease related genes
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence59
Ligand-Receptor Signaling (54)
54 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane_predicted | Phobius | Yes | ||||
| transmembrane_phobius | transmembrane_predicted | Almen2009 | Yes | ||||
| transmembrane_sosui | transmembrane_predicted | Almen2009 | Yes | ||||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | Yes |
Page 6 of 6Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ANGP4 | Q9Y264 | TIE1 | P35590 | Yes | Yes | Fantom5_LRdbCellTalkDBiTALKtalklrSignaLink3LRdbSTRING_talklrEMBRACE | SignaLink3:10051567CellTalkDB:15851516SignaLink3:23331499 | |
| TIE2 | Q02763 | TIE1 | P35590 | Yes | Yes | HPRDPhosphoPointSIGNOR | SIGNOR:15851516HPRD:10995770 | |
| ANGP1 | Q15389 | TIE1 | P35590 | Yes | Yes | HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020Baccin2019Ramilowski2015_Baccin2019CellinkerWangLRdbEMBRACEHPMR_talklr | CellTalkDB:11172728SIGNOR:11172728HPMR:11172728Baccin2019:11172728Cellinker:11172728LRdb:11172728connectomeDB2020:11172728 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
1,138
Mass
125,090
Sequence
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P35590-1; Sequence=Displayed; Name=2; IsoId=P35590-2; Sequence=VSP_047609, VSP_047610; Name=3; IsoId=P35590-3; Sequence=VSP_047607, VSP_047608
Alternative Sequence
305..317; ACAPGHFGADCRL -> VHQGHCGAREDHS (in isoform 3); 318..1138; Missing (in isoform 3); 348..379; DRIPQILNMASELEFNLETMPRINCAAAGNPF -> GWRDWVDTSTEKQNTDEGRFGGHVSAPVGAPG (in isoform 2); 380..1138; Missing (in isoform 2)
3D Structural Models
Beta Strand
648..656; 659..665; 676..682; 691..695; 701..707; 714..728
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
43..105; Ig-like C2-type 1; 214..256; EGF-like 1; 258..303; EGF-like 2; 305..345; EGF-like 3; 372..426; Ig-like C2-type 2; 446..545; Fibronectin type-III 1; 548..642; Fibronectin type-III 2; 646..739; Fibronectin type-III 3; 839..1118; Protein kinase
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- Tie subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.
Clinical Relevance
Drugs
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 34980157 | Proteomic analysis of extracellular vesicles secreted by primary human epithelial endometrial cells reveals key proteins related to embryo implantation. | No related sentences available |
| 39363010 | Proteomic analysis of plasma-derived extracellular vesicles: pre- and postprandial comparisons. | No related sentences available |
| 40222457 | Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement. | No related sentences available |
| 40595564 | Enrichment of extracellular vesicles using Mag-Net for the analysis of the plasma proteome. | No related sentences available |