Protein detail
ADDA
Alpha-adducin (Erythrocyte adducin subunit alpha)
Entry name ADDA | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 18 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Alpha-adducin (Erythrocyte adducin subunit alpha)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Adducin 1
Chromosome
4
Position
2843844-2930076
Supporting publications (n)
18
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificbrainCell SpecificKupffer cellsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (11)
- GO:0005634 nucleus
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0005925 focal adhesion
- GO:0008290 F-actin capping protein complex
- GO:0014069 postsynaptic density
Page 1 of 2
Molecular Function (11)
- GO:0003723 RNA binding
- GO:0003779 actin binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0030507 spectrin binding
- GO:0042803 protein homodimerization activity
- GO:0045296 cadherin binding
- GO:0046982 protein heterodimerization activity
- GO:0046983 protein dimerization activity
- GO:0051015 actin filament binding
Page 1 of 2
Biological Process (3)
Reactome (10)
- R-hsa-109581 apoptosis
- R-hsa-111465 apoptotic cleavage of cellular proteins
- R-hsa-75153 apoptotic execution phase
- R-hsa-264870 caspase mediated cleavage of cytoskeletal proteins
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-381070 ire1alpha activates chaperones
- R-hsa-5223345 miscellaneous transport and binding events
- R-hsa-5357801 programmed cell death
- R-hsa-382551 transport of small molecules
- R-hsa-381119 unfolded protein response upr
Mediation Categories (2)
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence76
Enzyme-Mediated Modification (61)
61 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ADD1 | ROCK1 | Q13464 | T | 445 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10209029ProtMapper:10209029KEA:10209029HPRD:10209029phosphoELM:10209029 |
| ADD1 | ROCK1 | Q13464 | T | 480 | phosphorylation | SIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:10209029HPRD:10209029SIGNOR:10209029KEA:10209029 |
| ADD1 | ROCK1 | Q13464 | T | 511 | phosphorylation | phosphoELM_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10209029KEA:10209029 |
| ADD1 | ROCK2 | O75116 | T | 445 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPdbPTMKEA | dbPTM:10209029KEA:10209029 |
| ADD1 | ROCK2 | O75116 | T | 480 | phosphorylation | dbPTMKEA | dbPTM:10209029KEA:10209029 |
| ADD1 | ROCK2 | O75116 | T | 511 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| ADD1 | PRKACA | P17612 | S | 436 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSite | SIGNOR:8810272HPRD:8810272KEA:8810272ProtMapper:8810272KEA:17081983HPRD:18669648 |
| ADD1 | PRKACA | P17612 | S | 481 | phosphorylation | SIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSite | ProtMapper:8810272SIGNOR:8810272KEA:8810272 |
| ADD1 | PRKACA | P17612 | S | 408 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSite | ProtMapper:8810272SIGNOR:8810272KEA:8810272 |
| ADD1 | PRKACA | P17612 | S | 726 | phosphorylation | PhosphoSiteKEA | KEA:9679146 |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | ADDA | P35611 | Yes | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksCui2007Kinexus_KEACA1WangPhosphoSite_ProtMapperBEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetKEAphosphoELMSIGNOR_ProtMapper | SIGNOR:8810272ProtMapper:15212693ProtMapper:9679146KEA:15611095CA1:8810272KEA:16116087SIGNOR:9679146KEA:8810272CA1:9679146ProtMapper:8810272phosphoELM:9679146iPTMnet:8810272KEA:17081983phosphoELM:15611095KEA:9679146 |
| KAPCA | P17612 | ADDA | P35611 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAHPRDCui2007Kinexus_KEACA1WangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | SIGNOR:8810272CA1:8810272HPRD:8810272KEA:8810272ProtMapper:8810272iPTMnet:8810272KEA:17081983HPRD-phos:8810272HPRD-phos:18669648ProtMapper:18669648KEA:9679146 | |
| KPCZ | Q05513 | ADDA | P35611 | Yes | Yes | BEL-Large-Corpus_ProtMapperPhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:8810272ProtMapper:15212693ProtMapper:9679146KEA:15611095SIGNOR:9679146KEA:16116087KEA:8810272ProtMapper:8810272iPTMnet:8810272KEA:17081983phosphoELM:15611095KEA:9679146 | |
| CDK5 | Q00535 | ADDA | P35611 | Yes | Yes | PhosphoSite_norefSIGNORPhosphoSite_ProtMapperProtMapper | SIGNOR:31548578 | |
| ROCK1 | Q13464 | ADDA | P35611 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | SIGNOR:10209029ProtMapper:10209029KEA:10209029PhosphoSite:24668294HPRD:10209029PhosphoSite:10209029phosphoELM:10209029HPRD-phos:10209029 | |
| CDK1 | P06493 | ADDA | P35611 | Yes | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_ProtMapperHPRD_MIMPPhosphoSite_norefiPTMnetProtMapperRLIMS-P_ProtMapperKEAREACH_ProtMapperPhosphoSiteNetworKIN_KEA | KEA:17570479ProtMapper:28476036PhosphoSite:24379415ProtMapper:24379415 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30950185 |
Sequence, Structure & Domains
Sequences
Length
737
Mass
80,955
Sequence
MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEGAAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS
Alternative Products
Event=Alternative splicing; Named isoforms=6; Comment=Additional isoforms seem to exist.; Name=1; IsoId=P35611-1; Sequence=Displayed; Name=2; IsoId=P35611-2; Sequence=VSP_000175, VSP_000176; Name=3; IsoId=P35611-3; Sequence=VSP_000174; Name=4; IsoId=P35611-4; Sequence=VSP_054420, VSP_000175, VSP_000176; Name=5; IsoId=P35611-5; Sequence=VSP_055402, VSP_055403; Name=6; IsoId=P35611-6; Sequence=VSP_000174, VSP_000175, VSP_000176
Alternative Sequence
471; K -> KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL (in isoform 3 and isoform 6); 472..511; WTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNL -> VWTNITHDHVKPLLQSLSSGVCVPSCITNCLVCAYLTVHS (in isoform 5); 512..737; Missing (in isoform 5); 535; Q -> QDAPLSDCTETIEGLELTEQTFSPAKSLSFRK (in isoform 4); 621..631; DLVPEPTTGDD -> GDGCAREYLLP (in isoform 2, isoform 4 and isoform 6); 632..737; Missing (in isoform 2, isoform 4 and isoform 6)
Domain & Motif Annotations
Compositional Bias
576..601; Basic and acidic residues; 602..614; Pro residues; 687..714; Low complexity; 715..737; Basic residues
Domain (CC)
Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
Region
1..21; Disordered; 421..486; Disordered; 576..737; Disordered; 717..734; Interaction with calmodulin
Protein Families (2)
- Aldolase class II family
- Adducin subfamily
Sequence Similarities
Belongs to the aldolase class II family. Adducin subfamily.
Clinical Relevance
Interaction Protein
ENSG00000075624
Interaction Count
1
Interaction Dataset
biogrid_opencell
Supporting Publications18
| PMID | Title | Related sentences |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No related sentences available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No related sentences available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No related sentences available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No related sentences available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
Page 1 of 2Next