Protein detail
ADDB
Beta-adducin (Erythrocyte adducin subunit beta)
Entry name ADDB | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 11 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Beta-adducin (Erythrocyte adducin subunit beta)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
ADDB
Gene Description
Adducin 2
Chromosome
2
Position
70607618-70768225
Supporting publications (n)
11
EVMP confidence score
0.72
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificeosinophilBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (7)
Molecular Function (9)
- GO:0003779 actin binding
- GO:0005200 structural constituent of cytoskeleton
- GO:0005516 calmodulin binding
- GO:0019901 protein kinase binding
- GO:0030507 spectrin binding
- GO:0042803 protein homodimerization activity
- GO:0046982 protein heterodimerization activity
- GO:0046983 protein dimerization activity
- GO:0051015 actin filament binding
Biological Process (3)
Reactome (2)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence44
Enzyme-Mediated Modification (31)
31 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ADD2 | PPP1R1B | Q9UD71 | S | 713 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:26639316 |
Page 4 of 4Previous
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | ADDB | P35612 | Yes | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:16116087ProtMapper:9679146SIGNOR:9679146KEA:16116087KEA:8810272SIGNOR:16116087KEA:9679146phosphoELM:8810272 | |
| KAPCA | P17612 | ADDB | P35612 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:9679146HPRD-phos:18452278SIGNOR:8810272HPRD-phos:9679146ProtMapper:9679146HPRD:8810272KEA:16116087KEA:8810272ProtMapper:18452278ProtMapper:8810272iPTMnet:8810272HPRD-phos:8810272KEA:9679146HPRD-phos:19664994ProtMapper:19664994 | |
| KPCD | Q05655 | ADDB | P35612 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:9679146HPRD-phos:18452278SIGNOR:8810272HPRD-phos:9679146ProtMapper:9679146HPRD:8810272KEA:16116087KEA:8810272ProtMapper:18452278ProtMapper:8810272iPTMnet:8810272HPRD-phos:8810272KEA:9679146HPRD-phos:19664994ProtMapper:19664994 | ||
| KPCZ | Q05513 | ADDB | P35612 | Yes | Yes | BEL-Large-Corpus_ProtMapperPhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:8810272ProtMapper:16116087ProtMapper:15212693KEA:16116087PhosphoSite:26639316KEA:8810272PhosphoSite:9679146SIGNOR:16116087PhosphoSite:16116087KEA:9679146PhosphoSite:15611095 | |
| FYN | P06241 | ADDB | P35612 | Yes | Sparser_ProtMapperPhosphoSite_MIMPMIMPiPTMnetPhosphoPointProtMapperHPRDRLIMS-P_ProtMapperSPIKE_LCREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16765915PhosphoSite:16765915HPRD:11526103ProtMapper:29723216SPIKE_LC:16713569ProtMapper:19838659ProtMapper:18634768 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
726
Mass
80,854
Sequence
MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKKKEKVES
Alternative Products
Event=Alternative splicing; Named isoforms=9; Comment=Additional isoforms seem to exist.; Name=1; IsoId=P35612-1; Sequence=Displayed; Name=2; Synonyms=Adducin 63; IsoId=P35612-2; Sequence=VSP_000181, VSP_000182; Name=3; Synonyms=Beta-4, E; IsoId=P35612-3; Sequence=VSP_000183; Name=4; Synonyms=Beta-4a; IsoId=P35612-4; Sequence=VSP_017244, VSP_017246; Name=5; Synonyms=Beta-4b; IsoId=P35612-5; Sequence=VSP_017242, VSP_017243, VSP_017245; Name=6; Synonyms=Beta-4c; IsoId=P35612-6; Sequence=VSP_017242, VSP_017244, VSP_017246; Name=7; Synonyms=Beta-4d; IsoId=P35612-7; Sequence=VSP_017241, VSP_017244, VSP_017246; Name=8; IsoId=P35612-8; Sequence=VSP_043625, VSP_000181, VSP_000182; Name=9; IsoId=P35612-9; Sequence=VSP_055309, VSP_000181, VSP_000182
Alternative Sequence
1; M -> MPRRRVPGANCKPTGK (in isoform 8); 1; M -> MPRRRVPGANCKPTGKM (in isoform 9); 78..566; Missing (in isoform 7); 188..493; Missing (in isoform 5 and isoform 6); 532..559; STESQLMSKGDEDTKDDSEETVPNPFSQ -> VEQRLPLTGGETCLPSGSSVPGAGLQDP (in isoform 2, isoform 8 and isoform 9); 560..726; Missing (in isoform 2, isoform 8 and isoform 9); 581..726; GEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKKKEKVES -> ETGQEREPGSGPAVCEFFSVALHIWSNILERKKLPQKSLAHLQSLHLLLQCRAQRRRQRQRAL (in isoform 3); 581..587; GEKETAP -> APGWFSS (in isoform 4, isoform 6 and isoform 7); 581..586; GEKETA -> ETGQER (in isoform 5); 587..726; Missing (in isoform 5); 588..726; Missing (in isoform 4, isoform 6 and isoform 7)
Domain & Motif Annotations
Compositional Bias
566..586; Basic and acidic residues; 588..606; Low complexity; 621..631; Basic and acidic residues; 632..645; Low complexity; 665..674; Polar residues; 689..701; Low complexity; 702..726; Basic residues
Domain (CC)
Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
Region
1..25; Disordered; 425..444; Interaction with calmodulin; 525..726; Disordered; 704..721; Interaction with calmodulin
Protein Families (2)
- Aldolase class II family
- Adducin subfamily
Sequence Similarities
Belongs to the aldolase class II family. Adducin subfamily.