Protein detail
VATE1
V-type proton ATPase subunit E 1 (V-ATPase subunit E 1) (V-ATPase 31 kDa subunit) (p31) (Vacuolar proton pump subunit E 1)
Protein symbol VATE1 | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count | Protein classification Disease related genesEssential proteinsHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsTransporters |
Basic Information
Protein Names
V-type proton ATPase subunit E 1 (V-ATPase subunit E 1) (V-ATPase 31 kDa subunit) (p31) (Vacuolar proton pump subunit E 1)
Protein Class
Disease related genesEssential proteinsHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Primary Active Transporters
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
ATP6EATP6E2ATP6V1EP31Vma4
Gene Description
ATPase H+ transporting V1 subunit E1
Chromosome
22
Position
17592136-17628749
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificAlveolar cells type 2Single-Nuclei Brain SpecificBergmann glia
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Primary Active Transporters
- Disease related genes
Cellular Component
- GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain
- GO:0005765 lysosomal membrane
- GO:0005768 endosome
- GO:0005829 cytosol
- GO:0005902 microvillus
- GO:0016324 apical plasma membrane
- GO:0016469 proton-transporting two-sector ATPase complex
- GO:0030665 clathrin-coated vesicle membrane
- GO:0030672 synaptic vesicle membrane
- GO:0070062 extracellular exosome
Molecular Function
Biological Process
KEGG
- hsa00190 Oxidative phosphorylation
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04142 Lysosome biogenesis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04150 mTOR signaling pathway
- KEGG:hsa04721 Synaptic vesicle cycle
- KEGG:hsa04966 Collecting duct acid secretion
- KEGG:hsa05110 Vibrio cholerae infection
- KEGG:hsa05120 Epithelial cell signaling in Helicobacter pylori infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05323 Rheumatoid arthritis
Reactome
- R-hsa-9639288 amino acids regulate mtorc1
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711097 cellular response to starvation
- R-hsa-168249 innate immune system
- R-hsa-77387 insulin receptor recycling
- R-hsa-983712 ion channel transport
- R-hsa-917937 iron uptake and transport
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-9857377 regulation of mitf m dependent genes involved in lysosome biogenesis and autophagy
- R-hsa-1222556 ros and rns production in phagocytes
- R-hsa-74752 signaling by insulin receptor
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-917977 transferrin endocytosis and recycling
- R-hsa-382551 transport of small molecules
Mediation Categories
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| proton-transporting two-sector ATPase complex | ATP6AP1ATP6V1AATP6V1C1ATP6V1E1ATP6V1F | P21283P36543P38606Q15904Q16864 | 1:1:1:1:1 | Compleat | Compleat:HC3099 | 8250920873313585817368463241 |
| ATP6V1E1ATP6V1G1SCAMP3ZNF827 | O14828O75348P36543Q17R98 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_326 | ||
| ATP6V1B1ATP6V1C2ATP6V1E1ATP6V1FATP6V1G1ATP6V1G2 | O75348O95670P15313P36543Q16864Q8NEY4 | 0:0:0:0:0:0 | hu.MAP2 | |||
| ATP6V1AATP6V1E1ATP6V1G1ATP6V1HUBC | O75348P0CG48P36543P38606Q9UI12 | 1:1:1:1:1 | CompleatCFinder | Compleat:HC8765 | ||
| ATP6V1E1SPAG7 | O75391P36543 | 0:0 | hu.MAP |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Mass Spectrometry | 1 | 38113368 |
Sequence, Structure & Domains
Sequences
Length
226
Mass
26,145
Sequence
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P36543-1; Sequence=Displayed; Name=2; IsoId=P36543-2; Sequence=VSP_042925; Name=3; IsoId=P36543-3; Sequence=VSP_044589
Alternative Sequence
12..33; Missing (in isoform 2); 93..122; Missing (in isoform 3)
3D Structural Models
Helix
35..107; 109..127; 138..140; 141..159; 196..206; 208..216
Beta Strand
4..6; 130..135; 164..167; 169..171; 179..184; 188..195
3D Structure
Electron microscopy (8)
Domain & Motif Annotations
Protein Families
V-ATPase E subunit family
Sequence Similarities
Belongs to the V-ATPase E subunit family.
Clinical Relevance
Disease Involvement
Disease variant
Drugs
Interaction Protein
ENSG00000033627ENSG00000047249ENSG00000100554ENSG00000114573ENSG00000116039ENSG00000128524ENSG00000136888ENSG00000147416ENSG00000155097ENSG00000182220ENSG00000213760
Interaction Count
11
Interaction Dataset
biogrid_opencellbiogrid_opencell_bioplexbiogrid_bioplexintact_biogrid_opencell_bioplexintact_biogrid_bioplex