Protein detail
GNAL
Guanine nucleotide-binding protein G(olf) subunit alpha (EC 3.6.5.-) (Adenylate cyclase-stimulating G alpha protein, olfactory type)
Entry name GNAL | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Guanine nucleotide-binding protein G(olf) subunit alpha (EC 3.6.5.-) (Adenylate cyclase-stimulating G alpha protein, olfactory type)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
G protein subunit alpha L
Chromosome
18
Position
11689264-11885685
Supporting publications (n)
4
EVMP confidence score
0.50
Fluorescence & Localization3
Cell SpecificEnterocytesBlood Cell Specificplasmacytoid DC
Function & Pathway7
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function (6)
Biological Process (3)
KEGG (7)
Reactome (13)
- R-hsa-170660 adenylate cyclase activating pathway
- R-hsa-170670 adenylate cyclase inhibitory pathway
- R-hsa-977444 gaba b receptor activation
- R-hsa-977443 gaba receptor activation
- R-hsa-418594 g alpha i signalling events
- R-hsa-112040 g protein mediated events
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-381753 olfactory signaling pathway
- R-hsa-111885 opioid signalling
Page 1 of 2
Mediation Categories
Receptor-signaling mediation
Relations & Evidence73
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (66)
66 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FFAR2 | O15552 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| GHSR | Q92847 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| MC5R | P33032 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| UR2R | Q9UKP6 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| GASR | P32239 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| PE2R1 | P34995 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| V1AR | P37288 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| MRGX2 | Q96LB1 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| AA2AR | P29274 | GNAL | P38405 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| GP132 | Q9UNW8 | GNAL | P38405 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Protein Complex Composition (1)
Sequence, Structure & Domains14
Sequences
Length
381
Mass
44,308
Sequence
MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLKQYELL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P38405-1; Sequence=Displayed; Name=2; IsoId=P38405-2; Sequence=VSP_043050; Name=3; IsoId=P38405-3; Sequence=VSP_045130
Alternative Sequence
1..207; Missing (in isoform 3); 1..41; MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKA -> MGLCYSLRPLLFGGPGDDPCAASEPPVEDAQPAPAPALAPVRAAARDTARTLLPRGGEGSPACARPKADKPKEKRQRTEQLSAEEREAAKEREAVKEARKVSRGIDRMLRDQKRDLQQ (in isoform 2)
3D Structural Models
Turn
219..224; 341..343
Helix
29..40; 55..62; 252..264; 281..290; 295..297; 300..302; 319..337; 358..364; 365..377
Beta Strand
45..47; 51..53; 195..197; 208..210; 230..234; 267..271; 273..278; 346..350
3D Structure
Electron microscopy (4)
Domain & Motif Annotations
Compositional Bias
10..25; Basic and acidic residues
Domain (FT)
41..381; G-alpha
Region
1..25; Disordered; 44..57; G1 motif; 183..191; G2 motif; 206..215; G3 motif; 275..282; G4 motif; 351..356; G5 motif
Protein Families (2)
- G-alpha family
- G(s) subfamily
Sequence Similarities
Belongs to the G-alpha family. G(s) subfamily.
Clinical Relevance2
Disease Involvement (2)
Disease variantDystonia
Antibody
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 25755179 | Urinary extracellular vesicles as reservoirs of altered proteins during the pathogenesis of polycystic kidney disease. | No abstract available |
| 33893753 | Label-free quantitative proteomic analysis of extracellular vesicles released from fibroblasts derived from patients with spinal muscular atrophy. | No abstract available |
| 37223008 | Proteomic analysis of urinary extracellular vesicles highlights specific signatures for patients with primary aldosteronism. | No abstract available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No abstract available |