Protein detail
CEAM6
Cell adhesion molecule CEACAM6 (Carcinoembryonic antigen-related cell adhesion molecule 6) (CEA cell adhesion molecule 6) (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)
Entry name CEAM6 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 8 | Transmembrane count | Protein classification Cancer-related genesCD markersPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Cell adhesion molecule CEACAM6 (Carcinoembryonic antigen-related cell adhesion molecule 6) (CEA cell adhesion molecule 6) (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)
Protein Class (4)
Cancer-related genesCD markersPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD66cNCA
Gene Description
CEA cell adhesion molecule 6
Chromosome
19
Position
41750977-41772211
Supporting publications (n)
8
EVMP confidence score
0.38
Fluorescence & Localization1
Cell SpecificAlveolar cells type 1
Function & Pathway6
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Cellular Component (7)
Molecular Function (3)
Biological Process (3)
Reactome (6)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence44
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | Yes | Yes |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | Yes |
| ig_like | adhesion | Almen2009 | Yes | Yes | No | Yes | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | Yes |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | Yes |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | Yes |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | Yes |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | Yes |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | Yes |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | Yes |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains11
Sequences
Length
344
Mass
37,237
Sequence
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
3D Structural Models
Turn
84..87
Helix
75..77; 114..116
Beta Strand
37..45; 51..57; 62..72; 78..83; 88..91; 99..101; 107..109; 118..126; 132..140
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Domain (CC)
The extracellular N-terminus Ig-like V-type domain is necessary for homophilic and heterophilic intercellular adhesion.
Domain (FT)
35..142; Ig-like V-type; 145..232; Ig-like C2-type 1; 240..314; Ig-like C2-type 2
Protein Families (2)
- Immunoglobulin superfamily
- CEA family
Sequence Similarities
Belongs to the immunoglobulin superfamily. CEA family.
Clinical Relevance3
Supporting Publications8
| PMID | Title | Abstract |
|---|---|---|
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 39949490 | CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro. | No abstract available |
| 40545963 | Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer. | No abstract available |
| 41201090 | Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma. | No abstract available |