Protein detail

CD79B

B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)

Entry name CD79B	UniProt ID P40259	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)

Protein Class (6)

Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins

Protein Function (6)

Cancer-related genes:Mutated cancer genes
CD markers
Human disease related genes:Immune system diseases:Primary immunodeficiency
Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
Disease related genes
FDA approved drug targets:Biotech drugs

Transmembrane

160..180; Helical

Transmembrane Count

Ensembl

ENSG00000007312

Entrez Gene Symbol

CD79B

Gene Synonym (4)

B29Ig-betaIGBIgbeta

Gene Description

CD79b molecule

Chromosome

Position

63928738-63932336

Supporting publications (n)

EVMP confidence score

0.50

Function & Pathway7

Protein Function (6)

Cancer-related genes:Mutated cancer genes
CD markers
Human disease related genes:Immune system diseases:Primary immunodeficiency
Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
Disease related genes
FDA approved drug targets:Biotech drugs

Cellular Component (5)

Molecular Function (3)

Biological Process (3)

KEGG

hsa04662 B cell receptor signaling pathway

Reactome (8)

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence60

Enzyme-Mediated Modification (26)

26 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CD79B	FYN	P06241	Y	207	phosphorylation	SIGNORProtMapperHPRDReactome_ProtMapperKEAphosphoELMSIGNOR_ProtMapper	KEA:8077654 HPRD:9531288 phosphoELM:9531288 SIGNOR:9531288 ProtMapper:9531288 KEA:9531288
CD79B	FYN	P06241	Y	196	phosphorylation	SIGNORProtMapperHPRDReactome_ProtMapperKEAphosphoELMSIGNOR_ProtMapper	KEA:8077654 HPRD:9531288 phosphoELM:9531288 SIGNOR:9531288 ProtMapper:9531288 KEA:9531288
CD79B	FYN	P06241	Y	103	phosphorylation	HPRDKEA	KEA:9531288 KEA:8077654 HPRD:9531288
CD79B	FYN	P06241	Y	92	phosphorylation	HPRDKEA	KEA:9531288 KEA:8077654 HPRD:9531288
CD79B	FYN	P06241	Y	197	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMP
CD79B	FYN	P06241	Y	208	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMP
CD79B	LYN	P07948	Y	207	phosphorylation	ProtMapperHPRDReactome_ProtMapperKEAphosphoELM	KEA:9531288 phosphoELM:9531288 KEA:8077654 HPRD:9531288
CD79B	LYN	P07948	Y	196	phosphorylation	SIGNORProtMapperHPRDReactome_ProtMapperKEAphosphoELMSIGNOR_ProtMapper	KEA:8077654 HPRD:9531288 phosphoELM:9531288 ProtMapper:9531288 SIGNOR:9531288 KEA:9531288 KEA:17570479
CD79B	LYN	P07948	Y	103	phosphorylation	HPRDKEA	KEA:9531288 KEA:8077654 HPRD:9531288
CD79B	LYN	P07948	Y	92	phosphorylation	HPRDKEA	KEA:9531288 KEA:8077654 HPRD:9531288

Page 1 of 3Next

Ligand-Receptor Signaling (29)

29 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	DGIdb	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No

Page 1 of 3Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LYN	P07948	CD79B	P40259	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangNetworKIN_KEAHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperSPIKE_LCSPIKE	SPIKE_LC:12453414 SPIKE:12453414 KEA:8077654 HPRD:9531288 phosphoELM:9531288 ProtMapper:9531288 SIGNOR:9531288 KEA:9531288 KEA:17570479 HPRD-phos:9531288
FYN	P06241	CD79B	P40259	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperHPRD-phos	KEA:8077654 HPRD:9531288 phosphoELM:9531288 ProtMapper:9531288 SIGNOR:9531288 KEA:9531288 HPRD-phos:9531288
SH2B1	Q9NRF2	CD79B	P40259	Yes	No	Yes	SIGNOR	SIGNOR:32323266

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CD79B	P40259	2	PDB	PDB:3kg5

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass spectrometry	1	32384937

Sequence, Structure & Domains11

Sequences

Length

229

Mass

26,048

Sequence

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=Long; IsoId=P40259-1; Sequence=Displayed; Name=Short; IsoId=P40259-2; Sequence=VSP_002477; Name=3; IsoId=P40259-3; Sequence=VSP_047222

Alternative Sequence

23; A -> AA (in isoform 3); 41..144; Missing (in isoform Short)

3D Structural Models

Turn

93..95

Helix

114..116; 151..181

Beta Strand

46..49; 51..56; 60..66; 69..72; 74..79; 96..100; 105..111; 118..125; 127..129; 132..134; 138..140

3D Structure

Electron microscopy (4); X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

The transmembrane helices of CD79A and CD79B chains and two IgM heavy chains assembly in a four-helix bundle structure that appears to be conserved among different BCR isotypes.

Domain (FT)

38..138; Ig-like V-type; 185..213; ITAM

Clinical Relevance6

Disease Involvement (3)

Cancer-related genesDisease variantFDA approved drug targets

Related Diseases (5)

Autoimmune disease Diffuse large B-cell lymphoma Follicular lymphoma Malignant haematopoietic neoplasm Mature B-cell lymphoma

Biomarker

Phase 1; Approved; Phase 2

Drug Targets

FDA approved drug targets

Drugs (3)

POLATUZUMAB VEDOTIN MGD-010 DIOA

Antibody (3)

HPA009178 CAB009751 HPA044107

Supporting Publications1

PMID	Title	Abstract
38902710	Exosomes multiplex profiling, a promising strategy for early diagnosis of laryngeal cancer.	Circulating exosomes were collected from serum collected from 30 LCa patients and 20 healthy volunteers by the use of antibody affinity method exploiting CD63 specific surface marker.